Detailed information
Overview
| Name | prx | Type | Regulator |
| Locus tag | A20_RS05760 | Genome accession | NC_018936 |
| Coordinates | 1144361..1144543 (-) | Length | 60 a.a. |
| NCBI ID | WP_011017964.1 | Uniprot ID | - |
| Organism | Streptococcus pyogenes A20 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1144361..1177847 | 1144361..1144543 | within | 0 |
Gene organization within MGE regions
Location: 1144361..1177847
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| A20_RS05760 (A20_1203c) | prx | 1144361..1144543 (-) | 183 | WP_011017964.1 | hypothetical protein | Regulator |
| A20_RS05765 (A20_1204) | sda3 | 1144782..1145582 (+) | 801 | WP_011285611.1 | streptodornase Sda3 | - |
| A20_RS05770 (A20_1205) | - | 1145853..1146287 (+) | 435 | WP_011017966.1 | hypothetical protein | - |
| A20_RS05775 (A20_1206c) | - | 1146357..1147562 (-) | 1206 | WP_010922446.1 | glucosaminidase domain-containing protein | - |
| A20_RS05785 (A20_1207c) | - | 1147678..1147905 (-) | 228 | WP_003058873.1 | phage holin | - |
| A20_RS05790 (A20_1208c) | - | 1147902..1148177 (-) | 276 | WP_002987582.1 | hypothetical protein | - |
| A20_RS05795 (A20_1209c) | - | 1148187..1148804 (-) | 618 | WP_011285613.1 | DUF1366 domain-containing protein | - |
| A20_RS05800 (A20_1210c) | - | 1148801..1149238 (-) | 438 | WP_011285614.1 | DUF1617 family protein | - |
| A20_RS05805 (A20_1211c) | - | 1149250..1151118 (-) | 1869 | WP_011285615.1 | gp58-like family protein | - |
| A20_RS05810 (A20_1212c) | - | 1151115..1151810 (-) | 696 | WP_010922452.1 | hypothetical protein | - |
| A20_RS05815 (A20_1213c) | - | 1151807..1154164 (-) | 2358 | WP_010922453.1 | hypothetical protein | - |
| A20_RS05820 (A20_1214c) | - | 1154164..1154535 (-) | 372 | WP_010922454.1 | DUF5361 domain-containing protein | - |
| A20_RS05825 (A20_1215c) | - | 1154550..1154813 (-) | 264 | WP_010922455.1 | hypothetical protein | - |
| A20_RS05830 (A20_1216c) | - | 1154824..1155417 (-) | 594 | WP_010922456.1 | tail protein | - |
| A20_RS05835 (A20_1217c) | - | 1155429..1155764 (-) | 336 | WP_011285616.1 | hypothetical protein | - |
| A20_RS05840 (A20_1218c) | - | 1155765..1156001 (-) | 237 | WP_010922457.1 | hypothetical protein | - |
| A20_RS05845 (A20_1219c) | - | 1155994..1156332 (-) | 339 | WP_011285617.1 | hypothetical protein | - |
| A20_RS05850 (A20_1220c) | - | 1156292..1156714 (-) | 423 | WP_010922459.1 | phage Gp19/Gp15/Gp42 family protein | - |
| A20_RS05855 (A20_1221c) | - | 1156724..1156924 (-) | 201 | WP_010922460.1 | hypothetical protein | - |
| A20_RS05860 (A20_1222c) | - | 1156924..1157835 (-) | 912 | WP_010922461.1 | phage major capsid protein | - |
| A20_RS05865 (A20_1223c) | - | 1157860..1158321 (-) | 462 | WP_011285618.1 | DUF4355 domain-containing protein | - |
| A20_RS05870 (A20_1224c) | - | 1158402..1159817 (-) | 1416 | WP_011285619.1 | terminase | - |
| A20_RS05875 (A20_1225c) | - | 1159927..1160193 (-) | 267 | WP_010922464.1 | hypothetical protein | - |
| A20_RS05880 (A20_1226c) | - | 1160186..1160365 (-) | 180 | WP_015055972.1 | hypothetical protein | - |
| A20_RS05885 (A20_1227c) | - | 1160415..1160639 (-) | 225 | WP_010922466.1 | hypothetical protein | - |
| A20_RS05890 (A20_1228c) | - | 1160645..1162138 (-) | 1494 | Protein_1121 | hypothetical protein | - |
| A20_RS05895 (A20_1229c) | - | 1162131..1163399 (-) | 1269 | WP_010922468.1 | phage portal protein | - |
| A20_RS05900 (A20_1230c) | - | 1163396..1163752 (-) | 357 | WP_002994106.1 | hypothetical protein | - |
| A20_RS05905 (A20_1231c) | - | 1163901..1164245 (-) | 345 | WP_010922469.1 | HNH endonuclease signature motif containing protein | - |
| A20_RS05910 (A20_1232c) | - | 1164354..1164773 (-) | 420 | WP_010922470.1 | DUF1492 domain-containing protein | - |
| A20_RS05915 (A20_1233c) | - | 1165041..1165676 (-) | 636 | WP_010922070.1 | N-6 DNA methylase | - |
| A20_RS05920 (A20_1234c) | - | 1165678..1165947 (-) | 270 | WP_002988369.1 | hypothetical protein | - |
| A20_RS05925 (A20_1235c) | - | 1166031..1166543 (-) | 513 | WP_002988366.1 | hypothetical protein | - |
| A20_RS05930 (A20_1236c) | - | 1166540..1166881 (-) | 342 | WP_002988364.1 | hypothetical protein | - |
| A20_RS09840 (A20_1237c) | - | 1167059..1167226 (-) | 168 | WP_011285624.1 | hypothetical protein | - |
| A20_RS05935 (A20_1238c) | - | 1167236..1168033 (-) | 798 | WP_011285625.1 | PD-(D/E)XK nuclease-like domain-containing protein | - |
| A20_RS05940 (A20_1239c) | - | 1168030..1168959 (-) | 930 | WP_011285626.1 | recombinase RecT | - |
| A20_RS05945 (A20_1240c) | - | 1168962..1169291 (-) | 330 | WP_002988359.1 | hypothetical protein | - |
| A20_RS05950 (A20_1241c) | - | 1169347..1169553 (-) | 207 | WP_011017565.1 | hypothetical protein | - |
| A20_RS09755 (A20_1242c) | - | 1169562..1169702 (-) | 141 | WP_011017992.1 | hypothetical protein | - |
| A20_RS05955 (A20_1243c) | - | 1169699..1169932 (-) | 234 | WP_002985387.1 | hypothetical protein | - |
| A20_RS05960 (A20_1244c) | - | 1169913..1170302 (-) | 390 | WP_011285627.1 | DnaD domain-containing protein | - |
| A20_RS09975 | - | 1170447..1170686 (-) | 240 | WP_002985390.1 | hypothetical protein | - |
| A20_RS05970 (A20_1245c) | - | 1170786..1170971 (-) | 186 | WP_011285628.1 | hypothetical protein | - |
| A20_RS05975 (A20_1246c) | - | 1170973..1171284 (-) | 312 | WP_002990080.1 | hypothetical protein | - |
| A20_RS05980 (A20_1247c) | - | 1171362..1171547 (-) | 186 | WP_011054585.1 | helix-turn-helix domain-containing protein | - |
| A20_RS05985 (A20_1248) | - | 1171714..1171953 (+) | 240 | WP_011284879.1 | hypothetical protein | - |
| A20_RS05990 (A20_1249) | - | 1172095..1172901 (+) | 807 | WP_011285629.1 | TIGR02391 family protein | - |
| A20_RS09490 | - | 1172836..1173102 (-) | 267 | WP_010922204.1 | hypothetical protein | - |
| A20_RS05995 (A20_1250c) | - | 1173134..1173850 (-) | 717 | WP_011285630.1 | phage antirepressor KilAC domain-containing protein | - |
| A20_RS06000 (A20_1251c) | - | 1173862..1174053 (-) | 192 | WP_002993390.1 | hypothetical protein | - |
| A20_RS09495 (A20_1252) | - | 1174689..1174784 (+) | 96 | WP_020837421.1 | type I toxin-antitoxin system Fst family toxin | - |
| A20_RS06005 (A20_1253) | - | 1175207..1175554 (+) | 348 | WP_011285631.1 | helix-turn-helix domain-containing protein | - |
| A20_RS06010 (A20_1254) | - | 1175558..1175938 (+) | 381 | WP_002994744.1 | ImmA/IrrE family metallo-endopeptidase | - |
| A20_RS06015 (A20_1255) | - | 1175950..1176216 (+) | 267 | WP_011285632.1 | DUF4177 domain-containing protein | - |
| A20_RS06020 (A20_1256) | - | 1176340..1177482 (+) | 1143 | WP_003051793.1 | tyrosine-type recombinase/integrase | - |
| A20_RS06025 (A20_1257c) | - | 1177572..1177847 (-) | 276 | WP_002983920.1 | HU family DNA-binding protein | - |
Sequence
Protein
Download Length: 60 a.a. Molecular weight: 6841.79 Da Isoelectric Point: 4.5183
>NTDB_id=54200 A20_RS05760 WP_011017964.1 1144361..1144543(-) (prx) [Streptococcus pyogenes A20]
MLTYDEFKQAIDNGYIAGDTVAIVRKDGQIFDYVLPHEKVKNGEVVTKEKVEEVLVELSR
MLTYDEFKQAIDNGYIAGDTVAIVRKDGQIFDYVLPHEKVKNGEVVTKEKVEEVLVELSR
Nucleotide
Download Length: 183 bp
>NTDB_id=54200 A20_RS05760 WP_011017964.1 1144361..1144543(-) (prx) [Streptococcus pyogenes A20]
ATGCTAACATACGACGAGTTTAAGCAAGCGATTGACAATGGATATATCGCAGGCGATACAGTAGCGATCGTGCGTAAAGA
CGGACAGATTTTTGATTATGTGTTGCCACATGAGAAAGTAAAGAATGGAGAAGTTGTGACTAAGGAAAAAGTGGAAGAGG
TGCTGGTGGAGCTTTCGAGATAA
ATGCTAACATACGACGAGTTTAAGCAAGCGATTGACAATGGATATATCGCAGGCGATACAGTAGCGATCGTGCGTAAAGA
CGGACAGATTTTTGATTATGTGTTGCCACATGAGAAAGTAAAGAATGGAGAAGTTGTGACTAAGGAAAAAGTGGAAGAGG
TGCTGGTGGAGCTTTCGAGATAA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS8232 |
100 |
100 |
1 |
| prx | Streptococcus pyogenes MGAS315 |
85 |
100 |
0.85 |
| prx | Streptococcus pyogenes MGAS315 |
80 |
100 |
0.8 |
| prx | Streptococcus pyogenes MGAS315 |
73.333 |
100 |
0.733 |
| prx | Streptococcus pyogenes MGAS315 |
90.244 |
68.333 |
0.617 |
| prx | Streptococcus pyogenes MGAS315 |
83.721 |
71.667 |
0.6 |
| prx | Streptococcus pyogenes MGAS315 |
78.571 |
70 |
0.55 |