Detailed information
Bioinformatically predicted
Overview
| Name | prx | Type | Regulator |
| Locus tag | A964_RS10455 | Genome accession | NC_018646 |
| Coordinates | 605142..605330 (+) | Length | 62 a.a. |
| NCBI ID | WP_000027835.1 | Uniprot ID | A0AAV3JNT7 |
| Organism | Streptococcus agalactiae GD201008-001 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Genomic island | 596395..605100 | 605142..605330 | flank | 42 |
| IS/Tn | 604096..604707 | 605142..605330 | flank | 435 |
Gene organization within MGE regions
Location: 596395..605330
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| A964_RS10450 (A964_0581) | - | 597774..597935 (-) | 162 | WP_000508795.1 | TM2 domain-containing protein | - |
| A964_RS03230 (A964_0582) | - | 598677..599954 (+) | 1278 | WP_000594368.1 | ABC transporter permease | - |
| A964_RS03235 (A964_0583) | - | 599964..600620 (+) | 657 | WP_000353149.1 | ABC transporter ATP-binding protein | - |
| A964_RS03240 (A964_0584) | - | 600620..601996 (+) | 1377 | WP_000594351.1 | ABC transporter permease | - |
| A964_RS03245 (A964_0585) | - | 602093..602746 (+) | 654 | WP_000699093.1 | response regulator transcription factor | - |
| A964_RS03250 (A964_0586) | - | 602743..604044 (+) | 1302 | WP_000734168.1 | sensor histidine kinase | - |
| A964_RS03255 (A964_0587) | - | 604096..604743 (-) | 648 | Protein_564 | IS3 family transposase | - |
| A964_RS03260 (A964_0588) | - | 604921..605100 (+) | 180 | WP_000076709.1 | CsbD family protein | - |
| A964_RS10455 (A964_0589) | prx | 605142..605330 (+) | 189 | WP_000027835.1 | hypothetical protein | Regulator |
Sequence
Protein
Download Length: 62 a.a. Molecular weight: 7180.25 Da Isoelectric Point: 4.7815
>NTDB_id=53529 A964_RS10455 WP_000027835.1 605142..605330(+) (prx) [Streptococcus agalactiae GD201008-001]
MSIRTDIDEFKEAIDKGYISGNTVAIVRKNGKIFDYVLLHEEVREEEVVTVERVLDVLRKLS
MSIRTDIDEFKEAIDKGYISGNTVAIVRKNGKIFDYVLLHEEVREEEVVTVERVLDVLRKLS
Nucleotide
Download Length: 189 bp
>NTDB_id=53529 A964_RS10455 WP_000027835.1 605142..605330(+) (prx) [Streptococcus agalactiae GD201008-001]
TTGTCTATCAGAACAGATATAGATGAGTTTAAAGAAGCGATTGATAAAGGCTATATTTCAGGGAACACAGTAGCGATAGT
GCGTAAAAACGGAAAGATATTTGATTATGTGTTACTACACGAAGAAGTGAGAGAAGAAGAGGTTGTTACAGTTGAGAGAG
TGCTTGATGTACTGAGGAAGTTATCATAA
TTGTCTATCAGAACAGATATAGATGAGTTTAAAGAAGCGATTGATAAAGGCTATATTTCAGGGAACACAGTAGCGATAGT
GCGTAAAAACGGAAAGATATTTGATTATGTGTTACTACACGAAGAAGTGAGAGAAGAAGAGGTTGTTACAGTTGAGAGAG
TGCTTGATGTACTGAGGAAGTTATCATAA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS315 |
72.222 |
87.097 |
0.629 |
| prx | Streptococcus pyogenes MGAS8232 |
69.091 |
88.71 |
0.613 |
| prx | Streptococcus pyogenes MGAS315 |
66.667 |
87.097 |
0.581 |
| prx | Streptococcus pyogenes MGAS315 |
85 |
64.516 |
0.548 |
| prx | Streptococcus pyogenes MGAS315 |
61.818 |
88.71 |
0.548 |
| prx | Streptococcus pyogenes MGAS315 |
74.359 |
62.903 |
0.468 |
| prx | Streptococcus pyogenes MGAS315 |
78.378 |
59.677 |
0.468 |