Detailed information
Bioinformatically predicted
Overview
| Name | prx | Type | Regulator |
| Locus tag | JQR77_RS00395 | Genome accession | NZ_CP069275 |
| Coordinates | 66487..66696 (+) | Length | 69 a.a. |
| NCBI ID | WP_023909312.1 | Uniprot ID | - |
| Organism | Streptococcus thermophilus strain EG007 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 24077..72726 | 66487..66696 | within | 0 |
Gene organization within MGE regions
Location: 24077..72726
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| JQR77_RS00185 (JQR77_00185) | mreC | 24077..24907 (+) | 831 | WP_011680583.1 | rod shape-determining protein MreC | - |
| JQR77_RS00190 (JQR77_00190) | mreD | 24909..25433 (+) | 525 | WP_002948139.1 | rod shape-determining protein MreD | - |
| JQR77_RS00195 (JQR77_00195) | - | 25518..26942 (+) | 1425 | WP_014727280.1 | CHAP domain-containing protein | - |
| JQR77_RS00200 (JQR77_00200) | - | 27156..28121 (+) | 966 | WP_002948994.1 | ribose-phosphate diphosphokinase | - |
| JQR77_RS00205 (JQR77_00205) | - | 28170..29015 (-) | 846 | Protein_19 | transposase | - |
| JQR77_RS00210 (JQR77_00210) | - | 29228..30403 (+) | 1176 | WP_011680586.1 | pyridoxal phosphate-dependent aminotransferase | - |
| JQR77_RS00215 (JQR77_00215) | recO | 30390..31163 (+) | 774 | WP_011680587.1 | DNA repair protein RecO | - |
| JQR77_RS00220 (JQR77_00220) | plsX | 31381..32385 (+) | 1005 | WP_023909290.1 | phosphate acyltransferase PlsX | - |
| JQR77_RS00225 (JQR77_00225) | - | 32385..32630 (+) | 246 | WP_002949008.1 | phosphopantetheine-binding protein | - |
| JQR77_RS00230 (JQR77_00230) | purC | 32915..33622 (+) | 708 | WP_023909291.1 | phosphoribosylaminoimidazolesuccinocarboxamide synthase | - |
| JQR77_RS00235 (JQR77_00235) | - | 33678..37403 (+) | 3726 | WP_084825609.1 | phosphoribosylformylglycinamidine synthase | - |
| JQR77_RS00240 (JQR77_00240) | purF | 37572..39011 (+) | 1440 | WP_011680591.1 | amidophosphoribosyltransferase | - |
| JQR77_RS00245 (JQR77_00245) | purM | 39039..40061 (+) | 1023 | WP_288577255.1 | phosphoribosylformylglycinamidine cyclo-ligase | - |
| JQR77_RS00250 (JQR77_00250) | purN | 40061..40615 (+) | 555 | WP_011225263.1 | phosphoribosylglycinamide formyltransferase | - |
| JQR77_RS00255 (JQR77_00255) | purH | 40684..42231 (+) | 1548 | WP_084825610.1 | bifunctional phosphoribosylaminoimidazolecarboxamide formyltransferase/IMP cyclohydrolase | - |
| JQR77_RS00260 (JQR77_00260) | - | 42403..43523 (+) | 1121 | Protein_30 | IS3 family transposase | - |
| JQR77_RS00265 (JQR77_00265) | - | 43628..44467 (-) | 840 | WP_011680595.1 | CHAP domain-containing protein | - |
| JQR77_RS00270 (JQR77_00270) | purD | 44776..46038 (+) | 1263 | WP_011225269.1 | phosphoribosylamine--glycine ligase | - |
| JQR77_RS00275 (JQR77_00275) | purE | 46384..46872 (+) | 489 | WP_002948169.1 | 5-(carboxyamino)imidazole ribonucleotide mutase | - |
| JQR77_RS00280 (JQR77_00280) | purK | 46859..47950 (+) | 1092 | WP_023909294.1 | 5-(carboxyamino)imidazole ribonucleotide synthase | - |
| JQR77_RS00285 (JQR77_00285) | - | 47987..48898 (+) | 912 | Protein_35 | ketopantoate reductase family protein | - |
| JQR77_RS00290 (JQR77_00290) | - | 48907..49131 (+) | 225 | Protein_36 | phosphoribosylaminoimidazole carboxylase | - |
| JQR77_RS00295 (JQR77_00295) | - | 49144..50388 (+) | 1245 | WP_023909295.1 | DUF4041 domain-containing protein | - |
| JQR77_RS00300 (JQR77_00300) | purB | 50633..51931 (+) | 1299 | WP_002948159.1 | adenylosuccinate lyase | - |
| JQR77_RS00305 (JQR77_00305) | argS | 52795..54486 (-) | 1692 | WP_014607827.1 | arginine--tRNA ligase | - |
| JQR77_RS00310 (JQR77_00310) | - | 54693..55859 (-) | 1167 | WP_023909297.1 | tyrosine-type recombinase/integrase | - |
| JQR77_RS00315 (JQR77_00315) | - | 55931..56497 (-) | 567 | WP_084825613.1 | helix-turn-helix transcriptional regulator | - |
| JQR77_RS00320 (JQR77_00320) | - | 56644..56841 (+) | 198 | WP_023909299.1 | helix-turn-helix transcriptional regulator | - |
| JQR77_RS00325 (JQR77_00325) | - | 57077..57379 (+) | 303 | WP_023909300.1 | hypothetical protein | - |
| JQR77_RS00330 (JQR77_00330) | - | 57383..57589 (+) | 207 | WP_022096594.1 | hypothetical protein | - |
| JQR77_RS00335 (JQR77_00335) | - | 57603..57839 (+) | 237 | WP_023909301.1 | hypothetical protein | - |
| JQR77_RS00340 (JQR77_00340) | - | 58175..58447 (+) | 273 | WP_023909303.1 | MerR family transcriptional regulator | - |
| JQR77_RS00345 (JQR77_00345) | - | 58463..59323 (+) | 861 | WP_023909304.1 | primase alpha helix C-terminal domain-containing protein | - |
| JQR77_RS00350 (JQR77_00350) | - | 59313..60821 (+) | 1509 | WP_023909305.1 | DNA primase family protein | - |
| JQR77_RS00355 (JQR77_00355) | - | 61111..61296 (+) | 186 | WP_023909306.1 | hypothetical protein | - |
| JQR77_RS00360 (JQR77_00360) | - | 61313..61588 (+) | 276 | WP_023909307.1 | hypothetical protein | - |
| JQR77_RS00365 (JQR77_00365) | - | 61816..62367 (+) | 552 | WP_084825664.1 | hypothetical protein | - |
| JQR77_RS00370 | - | 62576..62722 (-) | 147 | Protein_52 | protein rep | - |
| JQR77_RS00375 (JQR77_00370) | - | 62701..63072 (-) | 372 | WP_308250444.1 | protein rep | - |
| JQR77_RS00380 (JQR77_00375) | hdcB | 63177..63611 (-) | 435 | WP_220018527.1 | histidine decarboxylase maturation protein HdcB | - |
| JQR77_RS00385 (JQR77_00380) | - | 63628..65091 (-) | 1464 | WP_023909310.1 | amino acid permease | - |
| JQR77_RS00390 (JQR77_00385) | hdcA | 65115..66050 (-) | 936 | WP_023909311.1 | histidine decarboxylase, pyruvoyl type | - |
| JQR77_RS00395 (JQR77_00390) | prx | 66487..66696 (+) | 210 | WP_023909312.1 | hypothetical protein | Regulator |
| JQR77_RS00400 (JQR77_00395) | - | 66865..69942 (+) | 3078 | WP_269859803.1 | type I restriction endonuclease subunit R | - |
| JQR77_RS00405 (JQR77_00400) | - | 69942..71537 (+) | 1596 | WP_023910038.1 | type I restriction-modification system subunit M | - |
| JQR77_RS00410 (JQR77_00405) | - | 71527..72726 (+) | 1200 | WP_269859804.1 | restriction endonuclease subunit S | - |
Sequence
Protein
Download Length: 69 a.a. Molecular weight: 7912.06 Da Isoelectric Point: 4.6263
>NTDB_id=533178 JQR77_RS00395 WP_023909312.1 66487..66696(+) (prx) [Streptococcus thermophilus strain EG007]
MLTYDEFKEAMDKGFIKGDTVQIVRKNGKIHDYVLDGERVEPHEILSLEKVSDIIKELADELGVSKTYI
MLTYDEFKEAMDKGFIKGDTVQIVRKNGKIHDYVLDGERVEPHEILSLEKVSDIIKELADELGVSKTYI
Nucleotide
Download Length: 210 bp
>NTDB_id=533178 JQR77_RS00395 WP_023909312.1 66487..66696(+) (prx) [Streptococcus thermophilus strain EG007]
ATGCTAACCTATGATGAATTTAAAGAGGCTATGGACAAGGGTTTTATTAAAGGTGATACTGTCCAGATTGTCCGAAAGAA
TGGTAAGATACATGACTACGTTTTAGACGGTGAACGAGTTGAGCCACACGAAATATTAAGCTTAGAAAAGGTATCGGATA
TAATAAAGGAGTTAGCGGACGAGTTAGGCGTTAGTAAGACATATATATAG
ATGCTAACCTATGATGAATTTAAAGAGGCTATGGACAAGGGTTTTATTAAAGGTGATACTGTCCAGATTGTCCGAAAGAA
TGGTAAGATACATGACTACGTTTTAGACGGTGAACGAGTTGAGCCACACGAAATATTAAGCTTAGAAAAGGTATCGGATA
TAATAAAGGAGTTAGCGGACGAGTTAGGCGTTAGTAAGACATATATATAG
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS315 |
58.621 |
84.058 |
0.493 |
| prx | Streptococcus pyogenes MGAS8232 |
57.627 |
85.507 |
0.493 |
| prx | Streptococcus pyogenes MGAS315 |
57.627 |
85.507 |
0.493 |
| prx | Streptococcus pyogenes MGAS315 |
56.897 |
84.058 |
0.478 |
| prx | Streptococcus pyogenes MGAS315 |
73.81 |
60.87 |
0.449 |
| prx | Streptococcus pyogenes MGAS315 |
73.171 |
59.42 |
0.435 |
| prx | Streptococcus pyogenes MGAS315 |
68.182 |
63.768 |
0.435 |