Detailed information
Bioinformatically predicted
Overview
| Name | clpP | Type | Regulator |
| Locus tag | MHHHKEFG_RS16130 | Genome accession | NZ_CP069125 |
| Coordinates | 3106653..3107249 (+) | Length | 198 a.a. |
| NCBI ID | WP_034660066.1 | Uniprot ID | - |
| Organism | Bacillus pumilus strain D5 | ||
| Function | degradation of ComK; degradation of DegU (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 3042056..3107249 | 3106653..3107249 | within | 0 |
Gene organization within MGE regions
Location: 3042056..3107249
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| MHHHKEFG_RS15665 (MHHHKEFG_03192) | - | 3042056..3042844 (-) | 789 | WP_066030335.1 | helix-turn-helix domain-containing protein | - |
| MHHHKEFG_RS15670 (MHHHKEFG_03193) | - | 3042985..3043203 (+) | 219 | Protein_3028 | helix-turn-helix domain-containing protein | - |
| MHHHKEFG_RS15675 (MHHHKEFG_03194) | - | 3043261..3043512 (+) | 252 | WP_066030333.1 | hypothetical protein | - |
| MHHHKEFG_RS15680 (MHHHKEFG_03195) | - | 3043558..3043902 (+) | 345 | WP_081311367.1 | YolD-like family protein | - |
| MHHHKEFG_RS15685 (MHHHKEFG_03196) | - | 3043919..3044497 (-) | 579 | WP_066030332.1 | hypothetical protein | - |
| MHHHKEFG_RS15690 (MHHHKEFG_03197) | - | 3044566..3044805 (-) | 240 | WP_066030331.1 | phage holin | - |
| MHHHKEFG_RS15695 (MHHHKEFG_03198) | - | 3044802..3045641 (-) | 840 | WP_066030330.1 | N-acetylmuramoyl-L-alanine amidase | - |
| MHHHKEFG_RS15700 (MHHHKEFG_03199) | - | 3045667..3045933 (-) | 267 | WP_066030329.1 | hemolysin XhlA family protein | - |
| MHHHKEFG_RS15705 | - | 3045964..3046104 (-) | 141 | WP_074041882.1 | XkdX family protein | - |
| MHHHKEFG_RS15710 (MHHHKEFG_03201) | - | 3046104..3046391 (-) | 288 | WP_066030328.1 | hypothetical protein | - |
| MHHHKEFG_RS15715 (MHHHKEFG_03202) | - | 3046403..3047863 (-) | 1461 | WP_066030327.1 | phage baseplate upper protein | - |
| MHHHKEFG_RS15720 (MHHHKEFG_03203) | - | 3047878..3049758 (-) | 1881 | WP_066030326.1 | right-handed parallel beta-helix repeat-containing protein | - |
| MHHHKEFG_RS15725 (MHHHKEFG_03204) | - | 3049771..3051162 (-) | 1392 | WP_066030325.1 | phage tail protein | - |
| MHHHKEFG_RS15730 (MHHHKEFG_03205) | - | 3051174..3052601 (-) | 1428 | WP_066030324.1 | glucosaminidase domain-containing protein | - |
| MHHHKEFG_RS15735 (MHHHKEFG_03206) | - | 3052617..3055403 (-) | 2787 | WP_081311366.1 | phage tail tape measure protein | - |
| MHHHKEFG_RS15740 (MHHHKEFG_03207) | - | 3055425..3055577 (-) | 153 | WP_155758990.1 | hypothetical protein | - |
| MHHHKEFG_RS15745 (MHHHKEFG_03208) | - | 3055739..3056122 (-) | 384 | WP_066030323.1 | hypothetical protein | - |
| MHHHKEFG_RS15750 (MHHHKEFG_03209) | - | 3056178..3056708 (-) | 531 | WP_066030322.1 | hypothetical protein | - |
| MHHHKEFG_RS15755 (MHHHKEFG_03210) | - | 3056751..3057125 (-) | 375 | WP_066030321.1 | minor capsid protein | - |
| MHHHKEFG_RS15760 (MHHHKEFG_03211) | - | 3057125..3057535 (-) | 411 | WP_066030320.1 | hypothetical protein | - |
| MHHHKEFG_RS15765 (MHHHKEFG_03212) | - | 3057532..3057870 (-) | 339 | WP_066030319.1 | hypothetical protein | - |
| MHHHKEFG_RS15770 (MHHHKEFG_03213) | - | 3057871..3058257 (-) | 387 | WP_066030318.1 | hypothetical protein | - |
| MHHHKEFG_RS15775 (MHHHKEFG_03214) | - | 3058273..3058482 (-) | 210 | WP_066030317.1 | hypothetical protein | - |
| MHHHKEFG_RS15780 (MHHHKEFG_03215) | - | 3058482..3058766 (-) | 285 | WP_066030316.1 | hypothetical protein | - |
| MHHHKEFG_RS15785 (MHHHKEFG_03216) | - | 3058816..3059919 (-) | 1104 | WP_066030315.1 | DUF5309 family protein | - |
| MHHHKEFG_RS15790 (MHHHKEFG_03217) | - | 3059931..3060617 (-) | 687 | WP_066030314.1 | Clp protease ClpB | - |
| MHHHKEFG_RS15795 (MHHHKEFG_03218) | - | 3060681..3061511 (-) | 831 | WP_066030313.1 | phage minor capsid protein | - |
| MHHHKEFG_RS15800 (MHHHKEFG_03219) | - | 3061511..3063115 (-) | 1605 | WP_066030312.1 | phage portal protein | - |
| MHHHKEFG_RS15805 (MHHHKEFG_03220) | - | 3063119..3063544 (-) | 426 | WP_066030311.1 | phBC6A51 family helix-turn-helix protein | - |
| MHHHKEFG_RS15810 (MHHHKEFG_03221) | terL | 3063562..3065328 (-) | 1767 | WP_066030310.1 | phage terminase large subunit | - |
| MHHHKEFG_RS15815 (MHHHKEFG_03222) | - | 3065430..3065975 (+) | 546 | WP_066030309.1 | tyrosine-type recombinase/integrase | - |
| MHHHKEFG_RS15820 (MHHHKEFG_03223) | - | 3065990..3066235 (-) | 246 | WP_066030308.1 | hypothetical protein | - |
| MHHHKEFG_RS15825 (MHHHKEFG_03224) | - | 3066328..3066549 (-) | 222 | WP_066030307.1 | hypothetical protein | - |
| MHHHKEFG_RS15830 (MHHHKEFG_03225) | - | 3066665..3066952 (-) | 288 | WP_066030306.1 | hypothetical protein | - |
| MHHHKEFG_RS15835 (MHHHKEFG_03226) | - | 3066949..3067236 (-) | 288 | WP_066030305.1 | hypothetical protein | - |
| MHHHKEFG_RS15840 (MHHHKEFG_03227) | - | 3067238..3067519 (-) | 282 | WP_066030304.1 | hypothetical protein | - |
| MHHHKEFG_RS15845 | - | 3069036..3069176 (+) | 141 | WP_186320273.1 | hypothetical protein | - |
| MHHHKEFG_RS15850 (MHHHKEFG_03229) | - | 3069581..3069766 (+) | 186 | WP_066030302.1 | hypothetical protein | - |
| MHHHKEFG_RS15855 (MHHHKEFG_03230) | - | 3069766..3070152 (+) | 387 | WP_066030301.1 | hypothetical protein | - |
| MHHHKEFG_RS15860 | - | 3070166..3070297 (+) | 132 | WP_264188711.1 | hypothetical protein | - |
| MHHHKEFG_RS15865 | - | 3070341..3070517 (+) | 177 | WP_373861341.1 | hypothetical protein | - |
| MHHHKEFG_RS15870 (MHHHKEFG_03232) | - | 3070694..3071155 (+) | 462 | WP_066030300.1 | hypothetical protein | - |
| MHHHKEFG_RS15875 (MHHHKEFG_03233) | - | 3071129..3071938 (-) | 810 | WP_066030299.1 | hypothetical protein | - |
| MHHHKEFG_RS15880 (MHHHKEFG_03234) | - | 3071980..3072480 (-) | 501 | WP_066030298.1 | hypothetical protein | - |
| MHHHKEFG_RS15885 (MHHHKEFG_03235) | - | 3072623..3073009 (-) | 387 | WP_066030297.1 | sigma factor-like helix-turn-helix DNA-binding protein | - |
| MHHHKEFG_RS15890 (MHHHKEFG_03236) | - | 3073010..3074233 (-) | 1224 | WP_066030296.1 | class I SAM-dependent DNA methyltransferase | - |
| MHHHKEFG_RS15895 (MHHHKEFG_03238) | - | 3074664..3075710 (-) | 1047 | WP_066030294.1 | DNA cytosine methyltransferase | - |
| MHHHKEFG_RS15900 (MHHHKEFG_03239) | - | 3075707..3076261 (-) | 555 | WP_066030293.1 | hypothetical protein | - |
| MHHHKEFG_RS15905 (MHHHKEFG_03240) | - | 3076258..3077112 (-) | 855 | WP_066030292.1 | hypothetical protein | - |
| MHHHKEFG_RS15910 (MHHHKEFG_03241) | - | 3077112..3077393 (-) | 282 | WP_081311364.1 | hypothetical protein | - |
| MHHHKEFG_RS15915 (MHHHKEFG_03242) | - | 3077406..3077915 (-) | 510 | WP_066030291.1 | 3D domain-containing protein | - |
| MHHHKEFG_RS15920 (MHHHKEFG_03243) | thyX | 3077915..3078733 (-) | 819 | WP_081311363.1 | FAD-dependent thymidylate synthase | - |
| MHHHKEFG_RS15925 (MHHHKEFG_03244) | - | 3078734..3078946 (-) | 213 | WP_066030290.1 | hypothetical protein | - |
| MHHHKEFG_RS15930 | - | 3078950..3079126 (-) | 177 | WP_196769770.1 | hypothetical protein | - |
| MHHHKEFG_RS15935 (MHHHKEFG_03247) | - | 3079554..3079748 (-) | 195 | WP_066030288.1 | hypothetical protein | - |
| MHHHKEFG_RS15940 (MHHHKEFG_03248) | - | 3079749..3079919 (-) | 171 | WP_155758989.1 | hypothetical protein | - |
| MHHHKEFG_RS15945 (MHHHKEFG_03249) | nrdF | 3080043..3081017 (-) | 975 | WP_066030287.1 | class 1b ribonucleoside-diphosphate reductase subunit beta | - |
| MHHHKEFG_RS15950 (MHHHKEFG_03250) | nrdE | 3081038..3083143 (-) | 2106 | WP_081311362.1 | class 1b ribonucleoside-diphosphate reductase subunit alpha | - |
| MHHHKEFG_RS15955 (MHHHKEFG_03251) | nrdI | 3083140..3083496 (-) | 357 | WP_066030286.1 | class Ib ribonucleoside-diphosphate reductase assembly flavoprotein NrdI | - |
| MHHHKEFG_RS15960 (MHHHKEFG_03253) | - | 3083652..3083813 (-) | 162 | WP_155758988.1 | hypothetical protein | - |
| MHHHKEFG_RS15965 (MHHHKEFG_03255) | - | 3084016..3084372 (-) | 357 | WP_066030284.1 | hypothetical protein | - |
| MHHHKEFG_RS15970 (MHHHKEFG_03256) | - | 3084365..3084628 (-) | 264 | WP_066030283.1 | hypothetical protein | - |
| MHHHKEFG_RS15975 (MHHHKEFG_03257) | - | 3084634..3085152 (-) | 519 | WP_066030282.1 | hypothetical protein | - |
| MHHHKEFG_RS15980 (MHHHKEFG_03258) | - | 3085153..3085713 (-) | 561 | WP_066030281.1 | hypothetical protein | - |
| MHHHKEFG_RS15985 (MHHHKEFG_03259) | - | 3085710..3085889 (-) | 180 | WP_066030280.1 | hypothetical protein | - |
| MHHHKEFG_RS15990 (MHHHKEFG_03261) | - | 3086143..3087210 (-) | 1068 | WP_066030278.1 | hypothetical protein | - |
| MHHHKEFG_RS15995 (MHHHKEFG_03262) | - | 3087211..3087933 (-) | 723 | WP_066030277.1 | PolC-type DNA polymerase III | - |
| MHHHKEFG_RS16000 (MHHHKEFG_03263) | - | 3087933..3090173 (-) | 2241 | WP_066030276.1 | DNA polymerase | - |
| MHHHKEFG_RS16005 (MHHHKEFG_03264) | - | 3090213..3090374 (-) | 162 | WP_155758987.1 | hypothetical protein | - |
| MHHHKEFG_RS16010 (MHHHKEFG_03265) | - | 3090528..3091271 (-) | 744 | WP_066030275.1 | hypothetical protein | - |
| MHHHKEFG_RS16015 (MHHHKEFG_03266) | - | 3091312..3091746 (-) | 435 | WP_066030274.1 | hypothetical protein | - |
| MHHHKEFG_RS16020 (MHHHKEFG_03267) | - | 3091747..3092001 (-) | 255 | WP_066030273.1 | hypothetical protein | - |
| MHHHKEFG_RS16025 (MHHHKEFG_03268) | - | 3092015..3092794 (-) | 780 | WP_066030272.1 | hypothetical protein | - |
| MHHHKEFG_RS16030 (MHHHKEFG_03269) | - | 3093044..3093568 (-) | 525 | WP_066030271.1 | hypothetical protein | - |
| MHHHKEFG_RS16035 (MHHHKEFG_03271) | - | 3093843..3094280 (-) | 438 | WP_155758986.1 | hypothetical protein | - |
| MHHHKEFG_RS16040 (MHHHKEFG_03273) | - | 3094744..3095910 (-) | 1167 | WP_066030269.1 | AimR family lysis-lysogeny pheromone receptor | - |
| MHHHKEFG_RS16045 | - | 3096237..3096527 (+) | 291 | WP_081311361.1 | helix-turn-helix domain-containing protein | - |
| MHHHKEFG_RS16050 (MHHHKEFG_03275) | - | 3096524..3097525 (-) | 1002 | WP_066030267.1 | toprim domain-containing protein | - |
| MHHHKEFG_RS16055 (MHHHKEFG_03276) | - | 3097637..3099028 (-) | 1392 | WP_066031718.1 | DnaB-like helicase C-terminal domain-containing protein | - |
| MHHHKEFG_RS16060 (MHHHKEFG_03277) | - | 3099025..3099657 (-) | 633 | WP_081311478.1 | hypothetical protein | - |
| MHHHKEFG_RS16065 (MHHHKEFG_03278) | - | 3099658..3100419 (-) | 762 | WP_066031717.1 | ATP-binding protein | - |
| MHHHKEFG_RS16070 (MHHHKEFG_03279) | - | 3100409..3100606 (-) | 198 | WP_066031716.1 | hypothetical protein | - |
| MHHHKEFG_RS16075 (MHHHKEFG_03280) | - | 3100607..3101416 (-) | 810 | WP_066031715.1 | hypothetical protein | - |
| MHHHKEFG_RS16080 (MHHHKEFG_03281) | - | 3101418..3101786 (-) | 369 | WP_066031714.1 | hypothetical protein | - |
| MHHHKEFG_RS16085 (MHHHKEFG_03282) | - | 3101770..3102048 (-) | 279 | WP_066031713.1 | hypothetical protein | - |
| MHHHKEFG_RS16090 (MHHHKEFG_03283) | - | 3102048..3102392 (-) | 345 | WP_066031712.1 | hypothetical protein | - |
| MHHHKEFG_RS16095 (MHHHKEFG_03284) | - | 3102394..3102672 (-) | 279 | WP_066031711.1 | hypothetical protein | - |
| MHHHKEFG_RS16100 (MHHHKEFG_03285) | - | 3102696..3103031 (-) | 336 | WP_066031710.1 | hypothetical protein | - |
| MHHHKEFG_RS16105 (MHHHKEFG_03286) | - | 3103034..3103522 (-) | 489 | WP_066031709.1 | hypothetical protein | - |
| MHHHKEFG_RS16110 (MHHHKEFG_03287) | - | 3103725..3104102 (-) | 378 | WP_066031708.1 | helix-turn-helix domain-containing protein | - |
| MHHHKEFG_RS16115 (MHHHKEFG_03288) | - | 3104099..3105025 (-) | 927 | WP_066031707.1 | hypothetical protein | - |
| MHHHKEFG_RS16120 (MHHHKEFG_03289) | - | 3105155..3106141 (-) | 987 | WP_081311477.1 | tyrosine-type recombinase/integrase | - |
| MHHHKEFG_RS16130 (MHHHKEFG_03291) | clpP | 3106653..3107249 (+) | 597 | WP_034660066.1 | ATP-dependent Clp endopeptidase proteolytic subunit ClpP | Regulator |
Sequence
Protein
Download Length: 198 a.a. Molecular weight: 21832.99 Da Isoelectric Point: 4.6141
>NTDB_id=532407 MHHHKEFG_RS16130 WP_034660066.1 3106653..3107249(+) (clpP) [Bacillus pumilus strain D5]
MNLIPTVIEQTNRGERAYDIYSRLLKDRIIMLGSAIDDNVANSIVSQLLFLEAEDPEKDISIYINSPGGSITAGMAIYDT
MQFIKPKVSTICIGMAASMGAFLLAAGEKGKRYALPNSEVMIHQPLGGAQGQATEIEIAAKRILSLRDKLNQVLAERTGQ
PIEVIERDTDRDNFKTAEEALEYGLIDKVLTRNSEEQK
MNLIPTVIEQTNRGERAYDIYSRLLKDRIIMLGSAIDDNVANSIVSQLLFLEAEDPEKDISIYINSPGGSITAGMAIYDT
MQFIKPKVSTICIGMAASMGAFLLAAGEKGKRYALPNSEVMIHQPLGGAQGQATEIEIAAKRILSLRDKLNQVLAERTGQ
PIEVIERDTDRDNFKTAEEALEYGLIDKVLTRNSEEQK
Nucleotide
Download Length: 597 bp
>NTDB_id=532407 MHHHKEFG_RS16130 WP_034660066.1 3106653..3107249(+) (clpP) [Bacillus pumilus strain D5]
ATGAATTTAATACCTACAGTCATTGAGCAAACAAATCGTGGGGAAAGAGCTTACGACATTTATTCTCGTCTTTTAAAAGA
CCGTATTATCATGCTTGGTTCTGCGATCGATGACAATGTTGCCAACTCCATCGTGTCACAGCTGCTTTTCTTAGAAGCTG
AAGATCCAGAAAAAGATATTTCTATCTACATTAACAGCCCTGGCGGTTCGATCACAGCTGGTATGGCCATTTACGATACG
ATGCAATTTATTAAACCAAAGGTATCAACCATTTGTATTGGTATGGCTGCATCTATGGGTGCGTTCCTGCTTGCTGCTGG
TGAAAAAGGTAAGCGTTATGCCCTTCCAAACAGTGAAGTCATGATTCACCAACCACTAGGTGGTGCCCAAGGTCAAGCAA
CAGAAATTGAAATTGCGGCAAAACGAATCCTTTCTTTACGCGATAAACTGAACCAAGTACTTGCTGAACGTACTGGTCAG
CCAATTGAAGTGATTGAGCGCGATACAGATCGTGACAACTTCAAAACAGCGGAAGAAGCACTTGAATACGGACTCATTGA
CAAAGTCTTGACCCGTAATTCAGAAGAACAAAAATAA
ATGAATTTAATACCTACAGTCATTGAGCAAACAAATCGTGGGGAAAGAGCTTACGACATTTATTCTCGTCTTTTAAAAGA
CCGTATTATCATGCTTGGTTCTGCGATCGATGACAATGTTGCCAACTCCATCGTGTCACAGCTGCTTTTCTTAGAAGCTG
AAGATCCAGAAAAAGATATTTCTATCTACATTAACAGCCCTGGCGGTTCGATCACAGCTGGTATGGCCATTTACGATACG
ATGCAATTTATTAAACCAAAGGTATCAACCATTTGTATTGGTATGGCTGCATCTATGGGTGCGTTCCTGCTTGCTGCTGG
TGAAAAAGGTAAGCGTTATGCCCTTCCAAACAGTGAAGTCATGATTCACCAACCACTAGGTGGTGCCCAAGGTCAAGCAA
CAGAAATTGAAATTGCGGCAAAACGAATCCTTTCTTTACGCGATAAACTGAACCAAGTACTTGCTGAACGTACTGGTCAG
CCAATTGAAGTGATTGAGCGCGATACAGATCGTGACAACTTCAAAACAGCGGAAGAAGCACTTGAATACGGACTCATTGA
CAAAGTCTTGACCCGTAATTCAGAAGAACAAAAATAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| clpP | Bacillus subtilis subsp. subtilis str. 168 |
92.893 |
99.495 |
0.924 |
| clpP | Campylobacter jejuni subsp. jejuni NCTC 11168 = ATCC 700819 |
68.063 |
96.465 |
0.657 |
| clpP | Streptococcus thermophilus LMG 18311 |
59.067 |
97.475 |
0.576 |
| clpP | Streptococcus thermophilus LMD-9 |
59.067 |
97.475 |
0.576 |
| clpP | Lactococcus lactis subsp. cremoris KW2 |
57.216 |
97.98 |
0.561 |
| clpP | Streptococcus pneumoniae D39 |
56.701 |
97.98 |
0.556 |
| clpP | Streptococcus pneumoniae Rx1 |
56.701 |
97.98 |
0.556 |
| clpP | Streptococcus pneumoniae R6 |
56.701 |
97.98 |
0.556 |
| clpP | Streptococcus pneumoniae TIGR4 |
56.701 |
97.98 |
0.556 |
| clpP | Lactococcus lactis subsp. lactis strain DGCC12653 |
55.155 |
97.98 |
0.54 |
| clpP | Streptococcus pyogenes JRS4 |
55.44 |
97.475 |
0.54 |
| clpP | Streptococcus pyogenes MGAS315 |
55.44 |
97.475 |
0.54 |
| clpP | Streptococcus mutans UA159 |
54.639 |
97.98 |
0.535 |