Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   DI291_RS17115 Genome accession   NZ_CP068988
Coordinates   3383619..3383759 (-) Length   46 a.a.
NCBI ID   WP_003184860.1    Uniprot ID   P69890
Organism   Bacillus paralicheniformis strain SUBG0010     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 3378619..3388759
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  DI291_RS17090 (DI291_17600) - 3378919..3379308 (-) 390 WP_009329508.1 hotdog fold thioesterase -
  DI291_RS17095 (DI291_17605) comA 3379325..3379963 (-) 639 WP_003184849.1 response regulator transcription factor Regulator
  DI291_RS17100 (DI291_17610) comP 3380050..3382362 (-) 2313 WP_128823062.1 ATP-binding protein Regulator
  DI291_RS17105 (DI291_0685) comX 3382374..3382547 (-) 174 WP_080131484.1 competence pheromone ComX -
  DI291_RS17110 (DI291_17620) - 3382551..3383432 (-) 882 WP_128823060.1 polyprenyl synthetase family protein -
  DI291_RS17115 (DI291_17625) degQ 3383619..3383759 (-) 141 WP_003184860.1 degradation enzyme regulation protein DegQ Regulator
  DI291_RS17120 (DI291_17635) - 3384245..3384592 (+) 348 WP_224146417.1 SDR family oxidoreductase -
  DI291_RS17125 (DI291_17640) - 3384635..3385855 (-) 1221 WP_020452793.1 HDOD domain-containing protein -
  DI291_RS17130 (DI291_17645) - 3386033..3387442 (-) 1410 WP_229029889.1 nicotinate phosphoribosyltransferase -
  DI291_RS17135 (DI291_17650) - 3387520..3388071 (-) 552 WP_026580053.1 isochorismatase family cysteine hydrolase -
  DI291_RS17140 (DI291_17655) - 3388257..3388658 (-) 402 WP_026580054.1 YueI family protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5747.56 Da        Isoelectric Point: 8.4596

>NTDB_id=531865 DI291_RS17115 WP_003184860.1 3383619..3383759(-) (degQ) [Bacillus paralicheniformis strain SUBG0010]
MEKQQIEELKQLLWRLENEIRETKDSLRKINKSIDQYDKYTYLKTS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=531865 DI291_RS17115 WP_003184860.1 3383619..3383759(-) (degQ) [Bacillus paralicheniformis strain SUBG0010]
GTGGAAAAGCAACAAATTGAAGAATTAAAACAACTGCTTTGGCGGCTAGAGAATGAAATCAGAGAAACAAAGGACTCCTT
GCGCAAGATTAACAAAAGCATTGATCAATACGATAAGTACACATATCTAAAAACCTCGTAA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB P69890

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

71.429

91.304

0.652