Detailed information
Bioinformatically predicted
Overview
| Name | prx | Type | Regulator |
| Locus tag | I6J14_RS05340 | Genome accession | NZ_CP068057 |
| Coordinates | 1092730..1092912 (-) | Length | 60 a.a. |
| NCBI ID | WP_115252461.1 | Uniprot ID | - |
| Organism | Streptococcus dysgalactiae strain FDAARGOS_1157 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| ICE | 1046729..1106301 | 1092730..1092912 | within | 0 |
Gene organization within MGE regions
Location: 1046729..1106301
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| I6J14_RS05100 (I6J14_05100) | - | 1047708..1048706 (-) | 999 | WP_115252709.1 | glycosyltransferase | - |
| I6J14_RS05105 (I6J14_05105) | - | 1048783..1050246 (-) | 1464 | WP_003049928.1 | alpha-amylase | - |
| I6J14_RS05110 (I6J14_05110) | ccpA | 1050400..1051401 (-) | 1002 | WP_003049927.1 | catabolite control protein A | Regulator |
| I6J14_RS05115 (I6J14_05115) | - | 1051575..1052660 (+) | 1086 | WP_115253249.1 | Xaa-Pro peptidase family protein | - |
| I6J14_RS05120 (I6J14_05120) | - | 1052704..1053369 (+) | 666 | WP_003049925.1 | NAD(P)H-dependent oxidoreductase | - |
| I6J14_RS05125 (I6J14_05125) | - | 1053379..1053756 (+) | 378 | WP_003049924.1 | VOC family protein | - |
| I6J14_RS05130 (I6J14_05130) | - | 1054099..1055283 (+) | 1185 | WP_115252708.1 | DNA/RNA non-specific endonuclease | - |
| I6J14_RS05135 (I6J14_05135) | - | 1055420..1056346 (+) | 927 | WP_003049922.1 | glycosyltransferase family 2 protein | - |
| I6J14_RS10880 | - | 1056330..1056497 (-) | 168 | WP_236593289.1 | hypothetical protein | - |
| I6J14_RS05145 (I6J14_05145) | smpB | 1056856..1057323 (-) | 468 | WP_003049918.1 | SsrA-binding protein SmpB | - |
| I6J14_RS05150 (I6J14_05150) | rnr | 1057326..1059656 (-) | 2331 | WP_164549210.1 | ribonuclease R | - |
| I6J14_RS05155 (I6J14_05155) | secG | 1059753..1059989 (-) | 237 | WP_003047129.1 | preprotein translocase subunit SecG | - |
| I6J14_RS05160 (I6J14_05160) | rpmG | 1060035..1060181 (-) | 147 | WP_003047126.1 | 50S ribosomal protein L33 | - |
| I6J14_RS05165 (I6J14_05165) | - | 1060178..1061394 (-) | 1217 | Protein_1027 | multidrug efflux MFS transporter | - |
| I6J14_RS05170 (I6J14_05170) | - | 1061558..1063060 (-) | 1503 | WP_115252705.1 | helicase HerA-like domain-containing protein | - |
| I6J14_RS05175 (I6J14_05175) | - | 1063171..1064808 (-) | 1638 | WP_003049912.1 | hypothetical protein | - |
| I6J14_RS05180 (I6J14_05180) | - | 1064798..1065499 (-) | 702 | WP_003049910.1 | ABC transporter ATP-binding protein | - |
| I6J14_RS05185 (I6J14_05185) | coaE | 1065959..1066570 (-) | 612 | WP_003049907.1 | dephospho-CoA kinase | - |
| I6J14_RS05190 (I6J14_05190) | mutM | 1066549..1067376 (-) | 828 | WP_115252704.1 | DNA-formamidopyrimidine glycosylase | - |
| I6J14_RS05195 (I6J14_05195) | rgg2 | 1067558..1068412 (-) | 855 | WP_115253248.1 | quorum-sensing system transcriptional regulator Rgg2 | - |
| I6J14_RS05200 (I6J14_05200) | shp2 | 1068501..1068569 (+) | 69 | WP_134771781.1 | peptide pheromone SHP2 | - |
| I6J14_RS05205 (I6J14_05205) | - | 1068637..1070238 (+) | 1602 | WP_115276338.1 | transglutaminase domain-containing protein | - |
| I6J14_RS05210 (I6J14_05210) | - | 1070276..1070554 (+) | 279 | WP_115252703.1 | StcA family protein | - |
| I6J14_RS05215 (I6J14_05215) | - | 1070676..1071239 (-) | 564 | Protein_1037 | hypothetical protein | - |
| I6J14_RS05220 (I6J14_05220) | - | 1071311..1072416 (+) | 1106 | WP_115252702.1 | IS3 family transposase | - |
| I6J14_RS05225 (I6J14_05225) | - | 1072688..1072873 (-) | 186 | WP_003054392.1 | hypothetical protein | - |
| I6J14_RS05230 (I6J14_05230) | - | 1072887..1073108 (-) | 222 | WP_065956999.1 | Blp family class II bacteriocin | - |
| I6J14_RS05235 (I6J14_05235) | - | 1073534..1073851 (-) | 318 | WP_115252701.1 | role in replication | - |
| I6J14_RS05240 (I6J14_05240) | - | 1073900..1074127 (-) | 228 | WP_115252700.1 | ComC/BlpC family peptide pheromone/bacteriocin | - |
| I6J14_RS05245 (I6J14_05245) | - | 1074429..1076321 (+) | 1893 | Protein_1043 | peptide cleavage/export ABC transporter | - |
| I6J14_RS05250 (I6J14_05250) | - | 1076251..1076604 (-) | 354 | WP_115253247.1 | NUDIX domain-containing protein | - |
| I6J14_RS05255 (I6J14_05255) | era | 1076791..1077687 (-) | 897 | WP_003047080.1 | GTPase Era | - |
| I6J14_RS05260 (I6J14_05260) | - | 1077808..1078215 (-) | 408 | WP_003054389.1 | diacylglycerol kinase | - |
| I6J14_RS05265 (I6J14_05265) | ybeY | 1078196..1078693 (-) | 498 | WP_115252699.1 | rRNA maturation RNase YbeY | - |
| I6J14_RS05270 (I6J14_05270) | - | 1078852..1079427 (-) | 576 | WP_115252698.1 | uracil-DNA glycosylase family protein | - |
| I6J14_RS05275 (I6J14_05275) | - | 1079474..1080535 (-) | 1062 | WP_115252697.1 | PhoH family protein | - |
| I6J14_RS05280 (I6J14_05280) | - | 1080696..1082468 (-) | 1773 | WP_115252696.1 | oleate hydratase | - |
| I6J14_RS05285 (I6J14_05285) | - | 1082777..1083952 (-) | 1176 | WP_115246582.1 | LysM domain-containing protein | - |
| I6J14_RS05290 (I6J14_05290) | - | 1084090..1084305 (-) | 216 | WP_003049882.1 | YozE family protein | - |
| I6J14_RS05295 (I6J14_05295) | msrA | 1084302..1084811 (-) | 510 | WP_115252695.1 | peptide-methionine (S)-S-oxide reductase MsrA | - |
| I6J14_RS05300 (I6J14_05300) | cvfB | 1084883..1085740 (-) | 858 | WP_115252694.1 | RNA-binding virulence regulatory protein CvfB | - |
| I6J14_RS05305 (I6J14_05305) | frr | 1085859..1086416 (-) | 558 | WP_111715585.1 | ribosome recycling factor | - |
| I6J14_RS05310 (I6J14_05310) | pyrH | 1086445..1087173 (-) | 729 | WP_003049878.1 | UMP kinase | - |
| I6J14_RS05315 (I6J14_05315) | - | 1087455..1088075 (+) | 621 | WP_201621273.1 | hypothetical protein | - |
| I6J14_RS05320 (I6J14_05320) | rplA | 1088350..1089039 (-) | 690 | WP_003049876.1 | 50S ribosomal protein L1 | - |
| I6J14_RS05325 (I6J14_05325) | rplK | 1089145..1089570 (-) | 426 | WP_003049875.1 | 50S ribosomal protein L11 | - |
| I6J14_RS05330 (I6J14_05330) | - | 1089813..1090166 (+) | 354 | WP_037584912.1 | DUF3397 family protein | - |
| I6J14_RS05335 (I6J14_05335) | - | 1090235..1092643 (-) | 2409 | WP_115252693.1 | DNA translocase FtsK | - |
| I6J14_RS05340 (I6J14_05340) | prx | 1092730..1092912 (-) | 183 | WP_115252461.1 | Paratox | Regulator |
| I6J14_RS05345 (I6J14_05345) | spel | 1093029..1093778 (-) | 750 | WP_115276481.1 | streptococcal pyrogenic exotoxin SpeL | - |
| I6J14_RS05350 (I6J14_05350) | spem | 1094096..1094812 (-) | 717 | WP_115252463.1 | streptococcal pyrogenic exotoxin SpeM | - |
| I6J14_RS05355 (I6J14_05355) | - | 1094947..1095873 (-) | 927 | WP_115252464.1 | hypothetical protein | - |
| I6J14_RS05360 (I6J14_05360) | - | 1095878..1096054 (-) | 177 | WP_160147946.1 | hypothetical protein | - |
| I6J14_RS05365 (I6J14_05365) | - | 1096064..1096837 (-) | 774 | WP_115252465.1 | hypothetical protein | - |
| I6J14_RS05370 (I6J14_05370) | - | 1096848..1097450 (-) | 603 | WP_115252473.1 | hypothetical protein | - |
| I6J14_RS05375 (I6J14_05375) | - | 1097534..1098751 (-) | 1218 | WP_115253245.1 | peptidoglycan amidohydrolase family protein | - |
| I6J14_RS05380 (I6J14_05380) | - | 1098753..1099085 (-) | 333 | WP_115252466.1 | phage holin | - |
| I6J14_RS05385 (I6J14_05385) | - | 1099085..1099408 (-) | 324 | WP_115252467.1 | hypothetical protein | - |
| I6J14_RS11045 | - | 1099421..1099543 (-) | 123 | WP_255312504.1 | hypothetical protein | - |
| I6J14_RS05390 (I6J14_05390) | - | 1099557..1099907 (-) | 351 | WP_115252474.1 | DUF1366 domain-containing protein | - |
| I6J14_RS05395 (I6J14_05395) | - | 1099918..1101774 (-) | 1857 | WP_115252475.1 | DUF859 family phage minor structural protein | - |
| I6J14_RS05400 (I6J14_05400) | - | 1101779..1105228 (-) | 3450 | WP_115252476.1 | phage tail protein | - |
Sequence
Protein
Download Length: 60 a.a. Molecular weight: 7157.11 Da Isoelectric Point: 4.0474
>NTDB_id=526724 I6J14_RS05340 WP_115252461.1 1092730..1092912(-) (prx) [Streptococcus dysgalactiae strain FDAARGOS_1157]
MLTYDEFKQAIDDGYITGGTVMIVRKNGQIFDYVLPNEEIRDWEVVTEERVKEVMWELDK
MLTYDEFKQAIDDGYITGGTVMIVRKNGQIFDYVLPNEEIRDWEVVTEERVKEVMWELDK
Nucleotide
Download Length: 183 bp
>NTDB_id=526724 I6J14_RS05340 WP_115252461.1 1092730..1092912(-) (prx) [Streptococcus dysgalactiae strain FDAARGOS_1157]
ATGCTAACATACGATGAATTTAAGCAGGCAATTGATGACGGATATATCACAGGAGGCACAGTTATGATCGTGCGCAAAAA
CGGACAGATTTTTGATTATGTGTTGCCGAATGAGGAGATAAGAGATTGGGAGGTTGTGACAGAGGAGAGGGTGAAAGAGG
TGATGTGGGAATTAGACAAATAA
ATGCTAACATACGATGAATTTAAGCAGGCAATTGATGACGGATATATCACAGGAGGCACAGTTATGATCGTGCGCAAAAA
CGGACAGATTTTTGATTATGTGTTGCCGAATGAGGAGATAAGAGATTGGGAGGTTGTGACAGAGGAGAGGGTGAAAGAGG
TGATGTGGGAATTAGACAAATAA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS315 |
81.667 |
100 |
0.817 |
| prx | Streptococcus pyogenes MGAS315 |
76.667 |
100 |
0.767 |
| prx | Streptococcus pyogenes MGAS315 |
76.667 |
100 |
0.767 |
| prx | Streptococcus pyogenes MGAS315 |
75 |
100 |
0.75 |
| prx | Streptococcus pyogenes MGAS8232 |
70 |
100 |
0.7 |
| prx | Streptococcus pyogenes MGAS315 |
88.095 |
70 |
0.617 |
| prx | Streptococcus pyogenes MGAS315 |
73.81 |
70 |
0.517 |