Detailed information
Bioinformatically predicted
Overview
| Name | prx | Type | Regulator |
| Locus tag | C9Q_RS07160 | Genome accession | NZ_CP067090 |
| Coordinates | 1374148..1374330 (-) | Length | 60 a.a. |
| NCBI ID | WP_011054856.1 | Uniprot ID | - |
| Organism | Streptococcus pyogenes MGAS10870 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1374148..1415652 | 1374148..1374330 | within | 0 |
Gene organization within MGE regions
Location: 1374148..1415652
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| C9Q_RS07160 (C9Q_07120) | prx | 1374148..1374330 (-) | 183 | WP_011054856.1 | hypothetical protein | Regulator |
| C9Q_RS07165 | - | 1374569..1375204 (+) | 636 | WP_274758875.1 | hypothetical protein | - |
| C9Q_RS07170 | - | 1375182..1375550 (+) | 369 | WP_274758876.1 | hypothetical protein | - |
| C9Q_RS07175 (C9Q_07130) | - | 1375695..1376177 (-) | 483 | WP_274758877.1 | hypothetical protein | - |
| C9Q_RS07180 (C9Q_07135) | - | 1376499..1377701 (-) | 1203 | WP_011184057.1 | glucosaminidase domain-containing protein | - |
| C9Q_RS07185 (C9Q_07140) | - | 1377817..1378044 (-) | 228 | WP_003058873.1 | phage holin | - |
| C9Q_RS07190 (C9Q_07145) | - | 1378041..1378313 (-) | 273 | WP_002986916.1 | hypothetical protein | - |
| C9Q_RS07195 (C9Q_07150) | - | 1378323..1378941 (-) | 619 | Protein_1366 | DUF1366 domain-containing protein | - |
| C9Q_RS07200 (C9Q_07155) | - | 1378938..1379375 (-) | 438 | WP_011106643.1 | DUF1617 family protein | - |
| C9Q_RS07205 (C9Q_07160) | - | 1379387..1381402 (-) | 2016 | WP_032461307.1 | gp58-like family protein | - |
| C9Q_RS07210 (C9Q_07165) | - | 1381412..1382419 (-) | 1008 | WP_011054441.1 | hyaluronoglucosaminidase | - |
| C9Q_RS07215 (C9Q_07170) | - | 1382416..1384395 (-) | 1980 | WP_011054864.1 | phage tail protein | - |
| C9Q_RS07220 (C9Q_07175) | - | 1384405..1385247 (-) | 843 | WP_011054865.1 | phage tail family protein | - |
| C9Q_RS07225 (C9Q_07180) | - | 1385259..1389641 (-) | 4383 | WP_011054866.1 | tape measure protein | - |
| C9Q_RS07230 (C9Q_07185) | - | 1389656..1389889 (-) | 234 | WP_011054867.1 | hypothetical protein | - |
| C9Q_RS07235 (C9Q_07190) | - | 1389964..1390419 (-) | 456 | WP_011054868.1 | tail assembly chaperone | - |
| C9Q_RS07240 (C9Q_07195) | - | 1390473..1391072 (-) | 600 | WP_011054869.1 | phage major tail protein, TP901-1 family | - |
| C9Q_RS07245 (C9Q_07200) | - | 1391084..1391443 (-) | 360 | WP_011054870.1 | hypothetical protein | - |
| C9Q_RS07250 (C9Q_07205) | - | 1391447..1391791 (-) | 345 | WP_011106640.1 | HK97-gp10 family putative phage morphogenesis protein | - |
| C9Q_RS07255 (C9Q_07210) | - | 1391788..1392066 (-) | 279 | WP_011054872.1 | hypothetical protein | - |
| C9Q_RS07260 (C9Q_07215) | - | 1392077..1392433 (-) | 357 | WP_011054873.1 | phage head-tail connector protein | - |
| C9Q_RS07265 (C9Q_07220) | - | 1392445..1393332 (-) | 888 | WP_002983429.1 | hypothetical protein | - |
| C9Q_RS07270 (C9Q_07225) | - | 1393345..1393914 (-) | 570 | WP_011054874.1 | DUF4355 domain-containing protein | - |
| C9Q_RS07275 (C9Q_07230) | - | 1394082..1394348 (-) | 267 | WP_011054875.1 | hypothetical protein | - |
| C9Q_RS07280 (C9Q_07235) | - | 1394353..1394541 (-) | 189 | WP_011054876.1 | hypothetical protein | - |
| C9Q_RS07285 (C9Q_07240) | - | 1394569..1396017 (-) | 1449 | WP_011054877.1 | minor capsid protein | - |
| C9Q_RS07290 (C9Q_07245) | - | 1395977..1397509 (-) | 1533 | WP_011106638.1 | phage portal protein | - |
| C9Q_RS07295 (C9Q_07250) | - | 1397525..1398802 (-) | 1278 | WP_011054879.1 | PBSX family phage terminase large subunit | - |
| C9Q_RS07300 (C9Q_07255) | - | 1398792..1399244 (-) | 453 | WP_011106637.1 | terminase small subunit | - |
| C9Q_RS07305 (C9Q_07260) | - | 1399334..1399750 (-) | 417 | WP_011054881.1 | transcriptional regulator | - |
| C9Q_RS07310 (C9Q_07265) | - | 1399883..1400155 (-) | 273 | WP_011054882.1 | hypothetical protein | - |
| C9Q_RS07315 (C9Q_07270) | - | 1400148..1400318 (-) | 171 | WP_011054883.1 | hypothetical protein | - |
| C9Q_RS07320 (C9Q_07275) | - | 1400319..1401641 (-) | 1323 | WP_011054884.1 | SNF2-related protein | - |
| C9Q_RS07325 (C9Q_07280) | - | 1401638..1401913 (-) | 276 | WP_011054885.1 | VRR-NUC domain-containing protein | - |
| C9Q_RS07330 (C9Q_07285) | - | 1402279..1404663 (-) | 2385 | WP_011054886.1 | phage/plasmid primase, P4 family | - |
| C9Q_RS07335 (C9Q_07290) | - | 1404668..1406590 (-) | 1923 | WP_011054887.1 | DNA polymerase | - |
| C9Q_RS07340 (C9Q_07295) | - | 1406633..1407196 (-) | 564 | WP_011054888.1 | DUF2815 family protein | - |
| C9Q_RS07345 (C9Q_07300) | - | 1407210..1408367 (-) | 1158 | WP_011054889.1 | DUF2800 domain-containing protein | - |
| C9Q_RS07350 (C9Q_07305) | - | 1408367..1408666 (-) | 300 | WP_000573833.1 | hypothetical protein | - |
| C9Q_RS07355 (C9Q_07310) | - | 1408754..1408957 (-) | 204 | WP_011054890.1 | hypothetical protein | - |
| C9Q_RS07360 (C9Q_07315) | - | 1409157..1409486 (-) | 330 | WP_050428446.1 | hypothetical protein | - |
| C9Q_RS07365 (C9Q_07320) | - | 1409483..1409690 (-) | 208 | Protein_1400 | hypothetical protein | - |
| C9Q_RS07370 (C9Q_07325) | - | 1409683..1409853 (-) | 171 | WP_011054894.1 | hypothetical protein | - |
| C9Q_RS07375 (C9Q_07330) | - | 1409882..1410139 (-) | 258 | WP_011054895.1 | hypothetical protein | - |
| C9Q_RS07380 (C9Q_07335) | - | 1410227..1410427 (-) | 201 | WP_011184050.1 | hypothetical protein | - |
| C9Q_RS07385 (C9Q_07340) | - | 1410478..1410669 (-) | 192 | WP_001283052.1 | hypothetical protein | - |
| C9Q_RS07390 (C9Q_07345) | - | 1411308..1411658 (+) | 351 | WP_011184049.1 | helix-turn-helix transcriptional regulator | - |
| C9Q_RS07395 (C9Q_07350) | - | 1411672..1412055 (+) | 384 | WP_011054898.1 | ImmA/IrrE family metallo-endopeptidase | - |
| C9Q_RS07400 (C9Q_07355) | - | 1412066..1412617 (+) | 552 | WP_011054899.1 | hypothetical protein | - |
| C9Q_RS07405 (C9Q_07360) | - | 1412793..1413881 (+) | 1089 | WP_011054900.1 | site-specific integrase | - |
| C9Q_RS07410 (C9Q_07365) | - | 1414024..1415652 (-) | 1629 | WP_011054901.1 | ABC transporter permease | - |
Sequence
Protein
Download Length: 60 a.a. Molecular weight: 6927.67 Da Isoelectric Point: 3.9286
>NTDB_id=524959 C9Q_RS07160 WP_011054856.1 1374148..1374330(-) (prx) [Streptococcus pyogenes MGAS10870]
MLTYDEFKQAIDDGYITGDTVAIVRKNGQIFDYALPNEEVRNGEVVTYENVEEVLRELDK
MLTYDEFKQAIDDGYITGDTVAIVRKNGQIFDYALPNEEVRNGEVVTYENVEEVLRELDK
Nucleotide
Download Length: 183 bp
>NTDB_id=524959 C9Q_RS07160 WP_011054856.1 1374148..1374330(-) (prx) [Streptococcus pyogenes MGAS10870]
ATGCTAACATACGATGAGTTTAAGCAAGCTATTGATGACGGATATATCACAGGCGACACAGTGGCGATCGTGCGCAAAAA
CGGACAGATTTTTGATTATGCGTTGCCGAATGAAGAGGTAAGAAATGGGGAGGTTGTAACATACGAAAATGTGGAAGAAG
TGCTGAGGGAATTAGACAAATAA
ATGCTAACATACGATGAGTTTAAGCAAGCTATTGATGACGGATATATCACAGGCGACACAGTGGCGATCGTGCGCAAAAA
CGGACAGATTTTTGATTATGCGTTGCCGAATGAAGAGGTAAGAAATGGGGAGGTTGTAACATACGAAAATGTGGAAGAAG
TGCTGAGGGAATTAGACAAATAA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS315 |
100 |
100 |
1 |
| prx | Streptococcus pyogenes MGAS8232 |
80 |
100 |
0.8 |
| prx | Streptococcus pyogenes MGAS315 |
78.333 |
100 |
0.783 |
| prx | Streptococcus pyogenes MGAS315 |
75 |
100 |
0.75 |
| prx | Streptococcus pyogenes MGAS315 |
88.372 |
71.667 |
0.633 |
| prx | Streptococcus pyogenes MGAS315 |
87.805 |
68.333 |
0.6 |
| prx | Streptococcus pyogenes MGAS315 |
76.19 |
70 |
0.533 |