Detailed information
Bioinformatically predicted
Overview
| Name | prx | Type | Regulator |
| Locus tag | C9Q_RS06565 | Genome accession | NZ_CP067090 |
| Coordinates | 1276706..1276888 (-) | Length | 60 a.a. |
| NCBI ID | WP_011054793.1 | Uniprot ID | A0A5S4TJP1 |
| Organism | Streptococcus pyogenes MGAS10870 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1276706..1314674 | 1276706..1276888 | within | 0 |
Gene organization within MGE regions
Location: 1276706..1314674
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| C9Q_RS06565 (C9Q_06535) | prx | 1276706..1276888 (-) | 183 | WP_011054793.1 | hypothetical protein | Regulator |
| C9Q_RS06570 (C9Q_06540) | speA | 1277108..1277863 (+) | 756 | WP_011054794.1 | streptococcal pyrogenic exotoxin SpeA | - |
| C9Q_RS06575 (C9Q_06545) | - | 1277985..1278644 (-) | 660 | WP_009880240.1 | hypothetical protein | - |
| C9Q_RS06580 (C9Q_06550) | - | 1278644..1278865 (-) | 222 | WP_009880241.1 | hypothetical protein | - |
| C9Q_RS06585 (C9Q_06555) | - | 1278875..1279648 (-) | 774 | WP_011054795.1 | hypothetical protein | - |
| C9Q_RS06590 (C9Q_06560) | - | 1279659..1280261 (-) | 603 | WP_011054796.1 | hypothetical protein | - |
| C9Q_RS06595 (C9Q_06565) | - | 1280273..1281037 (-) | 765 | WP_011054797.1 | CHAP domain-containing protein | - |
| C9Q_RS06600 (C9Q_06570) | - | 1281039..1281371 (-) | 333 | WP_011054798.1 | phage holin | - |
| C9Q_RS06605 | - | 1281707..1281829 (-) | 123 | WP_015055953.1 | hypothetical protein | - |
| C9Q_RS06610 (C9Q_06575) | - | 1281843..1282190 (-) | 348 | WP_009880247.1 | DUF1366 domain-containing protein | - |
| C9Q_RS06615 (C9Q_06580) | - | 1282201..1284063 (-) | 1863 | WP_011106671.1 | DUF859 family phage minor structural protein | - |
| C9Q_RS06620 (C9Q_06585) | - | 1284068..1287508 (-) | 3441 | WP_011054801.1 | glucosaminidase domain-containing protein | - |
| C9Q_RS06625 (C9Q_06590) | - | 1287509..1288993 (-) | 1485 | WP_009880250.1 | distal tail protein Dit | - |
| C9Q_RS06630 (C9Q_06595) | - | 1288994..1290799 (-) | 1806 | WP_011054802.1 | tail protein | - |
| C9Q_RS06635 (C9Q_06600) | - | 1290792..1291250 (-) | 459 | WP_009880253.1 | hypothetical protein | - |
| C9Q_RS06640 (C9Q_06605) | - | 1291223..1291540 (-) | 318 | WP_009880254.1 | hypothetical protein | - |
| C9Q_RS06645 (C9Q_06610) | - | 1291553..1292059 (-) | 507 | WP_009880255.1 | phage major tail protein, TP901-1 family | - |
| C9Q_RS06650 (C9Q_06615) | - | 1292071..1292481 (-) | 411 | WP_009880256.1 | DUF5072 family protein | - |
| C9Q_RS06655 (C9Q_06620) | - | 1292483..1292878 (-) | 396 | WP_009880257.1 | hypothetical protein | - |
| C9Q_RS06660 (C9Q_06625) | - | 1292875..1293186 (-) | 312 | WP_009880258.1 | hypothetical protein | - |
| C9Q_RS06665 (C9Q_06630) | - | 1293183..1293527 (-) | 345 | WP_009880259.1 | hypothetical protein | - |
| C9Q_RS06670 (C9Q_06635) | - | 1293541..1293834 (-) | 294 | WP_009880260.1 | HeH/LEM domain-containing protein | - |
| C9Q_RS06675 (C9Q_06640) | - | 1293847..1294737 (-) | 891 | WP_009880261.1 | hypothetical protein | - |
| C9Q_RS06680 (C9Q_06645) | - | 1294755..1295327 (-) | 573 | WP_011054804.1 | DUF4355 domain-containing protein | - |
| C9Q_RS06685 (C9Q_06650) | - | 1295477..1295743 (-) | 267 | WP_011054805.1 | hypothetical protein | - |
| C9Q_RS06690 (C9Q_06655) | - | 1295750..1296658 (-) | 909 | WP_009880264.1 | minor capsid protein | - |
| C9Q_RS06695 (C9Q_06660) | - | 1296627..1297952 (-) | 1326 | WP_032461413.1 | phage portal protein | - |
| C9Q_RS06700 (C9Q_06665) | - | 1297952..1299226 (-) | 1275 | Protein_1279 | PBSX family phage terminase large subunit | - |
| C9Q_RS06705 (C9Q_06670) | - | 1299216..1299596 (-) | 381 | WP_011285571.1 | hypothetical protein | - |
| C9Q_RS06710 (C9Q_06675) | - | 1300206..1300640 (-) | 435 | WP_011054810.1 | ArpU family phage packaging/lysis transcriptional regulator | - |
| C9Q_RS06715 (C9Q_06680) | - | 1300924..1301094 (-) | 171 | WP_002987493.1 | hypothetical protein | - |
| C9Q_RS06720 (C9Q_06685) | - | 1301091..1301594 (-) | 504 | WP_011054811.1 | DUF1642 domain-containing protein | - |
| C9Q_RS06725 (C9Q_06690) | - | 1301881..1302066 (-) | 186 | WP_011054812.1 | hypothetical protein | - |
| C9Q_RS06730 (C9Q_06695) | - | 1302232..1302567 (-) | 336 | WP_011054813.1 | hypothetical protein | - |
| C9Q_RS06735 (C9Q_06700) | - | 1302570..1302854 (-) | 285 | WP_032461310.1 | hypothetical protein | - |
| C9Q_RS06740 (C9Q_06705) | - | 1302851..1303021 (-) | 171 | WP_011054814.1 | hypothetical protein | - |
| C9Q_RS06745 (C9Q_06710) | - | 1303018..1303431 (-) | 414 | WP_011054815.1 | YopX family protein | - |
| C9Q_RS06750 (C9Q_06715) | - | 1303428..1303712 (-) | 285 | WP_011018137.1 | DUF3310 domain-containing protein | - |
| C9Q_RS09530 | - | 1303706..1303957 (-) | 252 | WP_011106665.1 | hypothetical protein | - |
| C9Q_RS06755 (C9Q_06720) | - | 1303954..1304310 (-) | 357 | WP_011054816.1 | hypothetical protein | - |
| C9Q_RS06760 (C9Q_06725) | - | 1304294..1304614 (-) | 321 | WP_011054817.1 | VRR-NUC domain-containing protein | - |
| C9Q_RS06765 (C9Q_06730) | - | 1304859..1306339 (-) | 1481 | Protein_1293 | phage/plasmid primase, P4 family | - |
| C9Q_RS06775 (C9Q_06735) | - | 1306329..1307141 (-) | 813 | WP_011106664.1 | bifunctional DNA primase/polymerase | - |
| C9Q_RS06780 (C9Q_06740) | - | 1307144..1307602 (-) | 459 | WP_011054580.1 | DUF669 domain-containing protein | - |
| C9Q_RS06785 (C9Q_06745) | - | 1307618..1308847 (-) | 1230 | WP_011054819.1 | DEAD/DEAH box helicase | - |
| C9Q_RS06790 (C9Q_06750) | - | 1308949..1309629 (-) | 681 | WP_002995975.1 | AAA family ATPase | - |
| C9Q_RS06795 (C9Q_06755) | - | 1309630..1310112 (-) | 483 | WP_011054820.1 | siphovirus Gp157 family protein | - |
| C9Q_RS06800 (C9Q_06760) | - | 1310341..1310655 (-) | 315 | WP_011054583.1 | helix-turn-helix transcriptional regulator | - |
| C9Q_RS06805 (C9Q_06765) | - | 1310671..1310808 (-) | 138 | WP_011054821.1 | hypothetical protein | - |
| C9Q_RS06810 (C9Q_06770) | - | 1310839..1311090 (-) | 252 | WP_011054822.1 | hypothetical protein | - |
| C9Q_RS06815 (C9Q_06775) | - | 1311185..1311403 (-) | 219 | WP_009881062.1 | helix-turn-helix transcriptional regulator | - |
| C9Q_RS06820 (C9Q_06780) | - | 1311592..1311951 (+) | 360 | WP_011054823.1 | helix-turn-helix transcriptional regulator | - |
| C9Q_RS06825 (C9Q_06785) | - | 1311935..1312312 (+) | 378 | WP_011054824.1 | ImmA/IrrE family metallo-endopeptidase | - |
| C9Q_RS06830 (C9Q_06790) | - | 1312323..1312475 (+) | 153 | WP_011054825.1 | hypothetical protein | - |
| C9Q_RS06835 (C9Q_06795) | - | 1312744..1313334 (+) | 591 | WP_009880743.1 | hypothetical protein | - |
| C9Q_RS06840 (C9Q_06800) | - | 1313508..1314674 (+) | 1167 | WP_009880742.1 | site-specific integrase | - |
Sequence
Protein
Download Length: 60 a.a. Molecular weight: 7014.08 Da Isoelectric Point: 4.3313
>NTDB_id=524955 C9Q_RS06565 WP_011054793.1 1276706..1276888(-) (prx) [Streptococcus pyogenes MGAS10870]
MLYIDEFKEAIDKGYILGDTVAIVRKNGKIFDYVLPHEKVRDDEVVTVERVEEVMVELDK
MLYIDEFKEAIDKGYILGDTVAIVRKNGKIFDYVLPHEKVRDDEVVTVERVEEVMVELDK
Nucleotide
Download Length: 183 bp
>NTDB_id=524955 C9Q_RS06565 WP_011054793.1 1276706..1276888(-) (prx) [Streptococcus pyogenes MGAS10870]
ATGTTATATATAGATGAGTTTAAAGAAGCGATTGATAAGGGGTATATTTTAGGTGACACAGTAGCGATAGTGCGTAAAAA
CGGAAAGATATTTGATTATGTGTTACCACACGAAAAAGTGAGAGATGATGAAGTTGTGACGGTAGAGAGAGTGGAAGAAG
TGATGGTGGAATTAGACAAATAA
ATGTTATATATAGATGAGTTTAAAGAAGCGATTGATAAGGGGTATATTTTAGGTGACACAGTAGCGATAGTGCGTAAAAA
CGGAAAGATATTTGATTATGTGTTACCACACGAAAAAGTGAGAGATGATGAAGTTGTGACGGTAGAGAGAGTGGAAGAAG
TGATGGTGGAATTAGACAAATAA
Domains
No domain identified.
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS315 |
100 |
100 |
1 |
| prx | Streptococcus pyogenes MGAS315 |
78.333 |
100 |
0.783 |
| prx | Streptococcus pyogenes MGAS315 |
76.667 |
100 |
0.767 |
| prx | Streptococcus pyogenes MGAS315 |
75 |
100 |
0.75 |
| prx | Streptococcus pyogenes MGAS8232 |
75 |
100 |
0.75 |
| prx | Streptococcus pyogenes MGAS315 |
68.333 |
100 |
0.683 |
| prx | Streptococcus pyogenes MGAS315 |
76.19 |
70 |
0.533 |