Detailed information
Overview
| Name | prx | Type | Regulator |
| Locus tag | C9Q_RS05515 | Genome accession | NZ_CP067090 |
| Coordinates | 1101168..1101350 (-) | Length | 60 a.a. |
| NCBI ID | WP_011054671.1 | Uniprot ID | Q4VUT1 |
| Organism | Streptococcus pyogenes MGAS10870 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1101168..1135656 | 1101168..1101350 | within | 0 |
Gene organization within MGE regions
Location: 1101168..1135656
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| C9Q_RS05515 (C9Q_05500) | prx | 1101168..1101350 (-) | 183 | WP_011054671.1 | hypothetical protein | Regulator |
| C9Q_RS05520 (C9Q_05505) | - | 1101417..1102211 (-) | 795 | WP_002983479.1 | DNA/RNA non-specific endonuclease | - |
| C9Q_RS05525 (C9Q_05510) | - | 1102456..1103670 (-) | 1215 | WP_002983477.1 | peptidoglycan amidohydrolase family protein | - |
| C9Q_RS05530 (C9Q_05515) | - | 1103782..1104237 (-) | 456 | WP_002983475.1 | phage holin family protein | - |
| C9Q_RS05535 (C9Q_05520) | - | 1104248..1104862 (-) | 615 | WP_011054672.1 | DUF1366 domain-containing protein | - |
| C9Q_RS05540 (C9Q_05525) | - | 1104865..1105296 (-) | 432 | WP_011054673.1 | DUF1617 family protein | - |
| C9Q_RS05545 (C9Q_05530) | - | 1105305..1107086 (-) | 1782 | WP_011054674.1 | gp58-like family protein | - |
| C9Q_RS05550 (C9Q_05535) | - | 1107101..1108210 (-) | 1110 | WP_011054675.1 | hyaluronoglucosaminidase | - |
| C9Q_RS05555 (C9Q_05540) | - | 1108210..1110183 (-) | 1974 | WP_011054676.1 | phage tail spike protein | - |
| C9Q_RS05560 (C9Q_05545) | - | 1110165..1110860 (-) | 696 | WP_002992579.1 | hypothetical protein | - |
| C9Q_RS05565 (C9Q_05550) | - | 1110857..1113220 (-) | 2364 | WP_011054677.1 | hypothetical protein | - |
| C9Q_RS05570 (C9Q_05555) | - | 1113220..1113591 (-) | 372 | WP_011054678.1 | DUF5361 domain-containing protein | - |
| C9Q_RS05575 (C9Q_05560) | - | 1113606..1113869 (-) | 264 | WP_010922455.1 | hypothetical protein | - |
| C9Q_RS05580 (C9Q_05565) | - | 1113880..1114470 (-) | 591 | WP_011054679.1 | hypothetical protein | - |
| C9Q_RS05585 (C9Q_05570) | - | 1114486..1114821 (-) | 336 | WP_000573598.1 | hypothetical protein | - |
| C9Q_RS05590 (C9Q_05575) | - | 1114822..1115058 (-) | 237 | WP_000032787.1 | hypothetical protein | - |
| C9Q_RS05595 (C9Q_05580) | - | 1115051..1115389 (-) | 339 | WP_011054681.1 | hypothetical protein | - |
| C9Q_RS05600 (C9Q_05585) | - | 1115349..1115771 (-) | 423 | WP_011054682.1 | phage Gp19/Gp15/Gp42 family protein | - |
| C9Q_RS05605 (C9Q_05590) | - | 1115781..1115981 (-) | 201 | WP_010922460.1 | hypothetical protein | - |
| C9Q_RS05610 (C9Q_05595) | - | 1115981..1116892 (-) | 912 | WP_011054683.1 | phage major capsid protein | - |
| C9Q_RS05615 (C9Q_05600) | - | 1116917..1117378 (-) | 462 | WP_011054684.1 | DUF4355 domain-containing protein | - |
| C9Q_RS05620 (C9Q_05605) | - | 1117459..1118874 (-) | 1416 | WP_011054685.1 | terminase | - |
| C9Q_RS05625 (C9Q_05610) | - | 1118956..1119171 (-) | 216 | WP_011106704.1 | hypothetical protein | - |
| C9Q_RS05630 (C9Q_05615) | - | 1119173..1119439 (-) | 267 | WP_002986828.1 | hypothetical protein | - |
| C9Q_RS05635 (C9Q_05620) | - | 1119432..1119584 (-) | 153 | WP_011054687.1 | hypothetical protein | - |
| C9Q_RS05640 (C9Q_05625) | - | 1119661..1119885 (-) | 225 | WP_002994100.1 | hypothetical protein | - |
| C9Q_RS05645 (C9Q_05630) | - | 1119891..1121384 (-) | 1494 | WP_010922467.1 | hypothetical protein | - |
| C9Q_RS05650 (C9Q_05635) | - | 1121377..1122645 (-) | 1269 | WP_010922468.1 | phage portal protein | - |
| C9Q_RS05655 (C9Q_05640) | - | 1122642..1122998 (-) | 357 | WP_002994106.1 | hypothetical protein | - |
| C9Q_RS05660 (C9Q_05645) | - | 1123146..1123490 (-) | 345 | WP_011054690.1 | HNH endonuclease signature motif containing protein | - |
| C9Q_RS05665 (C9Q_05650) | - | 1123598..1124017 (-) | 420 | WP_011054691.1 | DUF1492 domain-containing protein | - |
| C9Q_RS05670 (C9Q_05655) | - | 1124093..1124344 (-) | 252 | WP_011054692.1 | hypothetical protein | - |
| C9Q_RS05675 (C9Q_05660) | - | 1124341..1124496 (-) | 156 | WP_011054693.1 | hypothetical protein | - |
| C9Q_RS05680 (C9Q_05665) | - | 1124493..1124810 (-) | 318 | WP_011054694.1 | DUF1372 family protein | - |
| C9Q_RS05685 (C9Q_05670) | - | 1124846..1125358 (-) | 513 | WP_011054695.1 | hypothetical protein | - |
| C9Q_RS05690 (C9Q_05675) | - | 1125355..1125687 (-) | 333 | WP_011054696.1 | hypothetical protein | - |
| C9Q_RS05695 (C9Q_05680) | - | 1125698..1127044 (-) | 1347 | WP_011054697.1 | PcfJ domain-containing protein | - |
| C9Q_RS05700 (C9Q_05685) | - | 1127041..1127436 (-) | 396 | WP_011054698.1 | Cas9 inhibitor AcrIIA9 family protein | - |
| C9Q_RS05705 (C9Q_05690) | - | 1127801..1128598 (-) | 798 | WP_011054699.1 | PD-(D/E)XK nuclease-like domain-containing protein | - |
| C9Q_RS05710 (C9Q_05695) | - | 1128591..1128791 (-) | 201 | WP_000594115.1 | hypothetical protein | - |
| C9Q_RS05715 (C9Q_05700) | - | 1128788..1129714 (-) | 927 | WP_011054700.1 | recombinase RecT | - |
| C9Q_RS05720 (C9Q_05705) | - | 1129717..1130047 (-) | 331 | Protein_1084 | hypothetical protein | - |
| C9Q_RS05725 (C9Q_05710) | - | 1130103..1130309 (-) | 207 | WP_002988357.1 | hypothetical protein | - |
| C9Q_RS05730 (C9Q_05715) | - | 1130318..1130458 (-) | 141 | WP_002988354.1 | hypothetical protein | - |
| C9Q_RS05735 (C9Q_05720) | - | 1130455..1130688 (-) | 234 | WP_010922205.1 | hypothetical protein | - |
| C9Q_RS05740 (C9Q_05725) | - | 1130669..1131055 (-) | 387 | WP_011017564.1 | DnaD domain-containing protein | - |
| C9Q_RS05745 | - | 1131196..1131465 (-) | 270 | WP_011106700.1 | replication protein | - |
| C9Q_RS05750 (C9Q_05730) | - | 1131559..1131744 (-) | 186 | WP_010922477.1 | hypothetical protein | - |
| C9Q_RS05755 (C9Q_05735) | - | 1131746..1132057 (-) | 312 | WP_010922478.1 | excisionase | - |
| C9Q_RS05760 (C9Q_05740) | - | 1132327..1132539 (-) | 213 | WP_010922479.1 | helix-turn-helix transcriptional regulator | - |
| C9Q_RS05765 (C9Q_05745) | - | 1132741..1133496 (+) | 756 | WP_010922480.1 | XRE family transcriptional regulator | - |
| C9Q_RS05770 (C9Q_05750) | - | 1133508..1134026 (+) | 519 | WP_010922481.1 | HIRAN domain-containing protein | - |
| C9Q_RS05775 (C9Q_05755) | - | 1134150..1135292 (+) | 1143 | WP_003051793.1 | site-specific integrase | - |
| C9Q_RS05780 (C9Q_05760) | - | 1135381..1135656 (-) | 276 | WP_002983920.1 | HU family DNA-binding protein | - |
Sequence
Protein
Download Length: 60 a.a. Molecular weight: 6978.99 Da Isoelectric Point: 4.3466
>NTDB_id=524950 C9Q_RS05515 WP_011054671.1 1101168..1101350(-) (prx) [Streptococcus pyogenes MGAS10870]
MLTYDEFKQAIDRGYITADTVMIVRKNGQIFDYVLPNEKIKNGEIVTDEKVEEVLVELSR
MLTYDEFKQAIDRGYITADTVMIVRKNGQIFDYVLPNEKIKNGEIVTDEKVEEVLVELSR
Nucleotide
Download Length: 183 bp
>NTDB_id=524950 C9Q_RS05515 WP_011054671.1 1101168..1101350(-) (prx) [Streptococcus pyogenes MGAS10870]
ATGCTAACATACGACGAATTTAAGCAAGCTATTGACCGTGGATATATCACAGCAGACACAGTAATGATCGTGCGCAAGAA
CGGACAGATTTTTGATTATGTGTTGCCGAATGAGAAGATAAAGAATGGAGAAATTGTGACAGACGAAAAAGTGGAAGAGG
TGCTGGTGGAGCTTTCGAGATAA
ATGCTAACATACGACGAATTTAAGCAAGCTATTGACCGTGGATATATCACAGCAGACACAGTAATGATCGTGCGCAAGAA
CGGACAGATTTTTGATTATGTGTTGCCGAATGAGAAGATAAAGAATGGAGAAATTGTGACAGACGAAAAAGTGGAAGAGG
TGCTGGTGGAGCTTTCGAGATAA
Domains
No domain identified.
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS315 |
100 |
100 |
1 |
| prx | Streptococcus pyogenes MGAS8232 |
85 |
100 |
0.85 |
| prx | Streptococcus pyogenes MGAS315 |
78.333 |
100 |
0.783 |
| prx | Streptococcus pyogenes MGAS315 |
73.333 |
100 |
0.733 |
| prx | Streptococcus pyogenes MGAS315 |
83.721 |
71.667 |
0.6 |
| prx | Streptococcus pyogenes MGAS315 |
82.927 |
68.333 |
0.567 |
| prx | Streptococcus pyogenes MGAS315 |
71.429 |
70 |
0.5 |