Detailed information
Bioinformatically predicted
Overview
| Name | prx | Type | Regulator |
| Locus tag | JHX98_RS05845 | Genome accession | NZ_CP067010 |
| Coordinates | 1146438..1146620 (-) | Length | 60 a.a. |
| NCBI ID | WP_011888783.1 | Uniprot ID | - |
| Organism | Streptococcus pyogenes strain iGAS376 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1146438..1187899 | 1146438..1146620 | within | 0 |
Gene organization within MGE regions
Location: 1146438..1187899
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| JHX98_RS05845 (JHX98_05845) | prx | 1146438..1146620 (-) | 183 | WP_011888783.1 | hypothetical protein | Regulator |
| JHX98_RS05850 (JHX98_05850) | - | 1146686..1147480 (-) | 795 | WP_011888782.1 | DNA/RNA non-specific endonuclease | - |
| JHX98_RS05855 (JHX98_05855) | - | 1147702..1147902 (-) | 201 | WP_011888781.1 | CsbD family protein | - |
| JHX98_RS05860 (JHX98_05860) | - | 1148086..1149057 (-) | 972 | WP_011888780.1 | Abi family protein | - |
| JHX98_RS05865 (JHX98_05865) | - | 1149351..1150568 (-) | 1218 | WP_023077240.1 | peptidoglycan amidohydrolase family protein | - |
| JHX98_RS05870 (JHX98_05870) | - | 1150682..1150867 (-) | 186 | WP_011888776.1 | holin | - |
| JHX98_RS05875 (JHX98_05875) | - | 1150864..1151163 (-) | 300 | WP_002988799.1 | hypothetical protein | - |
| JHX98_RS05880 (JHX98_05880) | - | 1151174..1151806 (-) | 633 | WP_011888775.1 | hypothetical protein | - |
| JHX98_RS05885 (JHX98_05885) | - | 1151809..1152237 (-) | 429 | WP_011888774.1 | DUF1617 family protein | - |
| JHX98_RS05890 (JHX98_05890) | - | 1152249..1154033 (-) | 1785 | WP_011888773.1 | gp58-like family protein | - |
| JHX98_RS05895 (JHX98_05895) | hylP | 1154048..1155064 (-) | 1017 | WP_072135668.1 | hyaluronidase HylP | - |
| JHX98_RS05900 (JHX98_05900) | - | 1155061..1157037 (-) | 1977 | WP_041174190.1 | phage tail spike protein | - |
| JHX98_RS05905 (JHX98_05905) | - | 1157019..1157714 (-) | 696 | WP_011888770.1 | hypothetical protein | - |
| JHX98_RS05910 (JHX98_05910) | - | 1157711..1160068 (-) | 2358 | WP_011888769.1 | hypothetical protein | - |
| JHX98_RS05915 (JHX98_05915) | - | 1160068..1160439 (-) | 372 | WP_011528785.1 | DUF5361 domain-containing protein | - |
| JHX98_RS05920 (JHX98_05920) | - | 1160454..1160717 (-) | 264 | WP_010922455.1 | hypothetical protein | - |
| JHX98_RS05925 (JHX98_05925) | - | 1160728..1161306 (-) | 579 | WP_011888768.1 | hypothetical protein | - |
| JHX98_RS05930 (JHX98_05930) | - | 1161318..1161653 (-) | 336 | WP_000573598.1 | hypothetical protein | - |
| JHX98_RS05935 (JHX98_05935) | - | 1161654..1161890 (-) | 237 | WP_000032787.1 | hypothetical protein | - |
| JHX98_RS05940 (JHX98_05940) | - | 1161883..1162221 (-) | 339 | WP_011054681.1 | hypothetical protein | - |
| JHX98_RS05945 (JHX98_05945) | - | 1162181..1162603 (-) | 423 | WP_011054682.1 | phage Gp19/Gp15/Gp42 family protein | - |
| JHX98_RS05950 (JHX98_05950) | - | 1162613..1162813 (-) | 201 | WP_010922460.1 | hypothetical protein | - |
| JHX98_RS05955 (JHX98_05955) | - | 1162813..1163724 (-) | 912 | WP_011888767.1 | phage major capsid protein | - |
| JHX98_RS05960 (JHX98_05960) | - | 1163749..1164210 (-) | 462 | WP_011888766.1 | DUF4355 domain-containing protein | - |
| JHX98_RS05965 (JHX98_05965) | - | 1164281..1165696 (-) | 1416 | WP_011888765.1 | terminase | - |
| JHX98_RS05970 (JHX98_05970) | - | 1165778..1166014 (-) | 237 | WP_011888764.1 | hypothetical protein | - |
| JHX98_RS05975 (JHX98_05975) | - | 1166016..1166282 (-) | 267 | WP_002986828.1 | hypothetical protein | - |
| JHX98_RS05980 (JHX98_05980) | - | 1166275..1166427 (-) | 153 | WP_011054687.1 | hypothetical protein | - |
| JHX98_RS05985 (JHX98_05985) | - | 1166504..1166728 (-) | 225 | WP_002994100.1 | hypothetical protein | - |
| JHX98_RS05990 (JHX98_05990) | - | 1166734..1168227 (-) | 1494 | WP_011017978.1 | hypothetical protein | - |
| JHX98_RS05995 (JHX98_05995) | - | 1168220..1169488 (-) | 1269 | WP_076640885.1 | phage portal protein | - |
| JHX98_RS06000 (JHX98_06000) | - | 1169485..1169841 (-) | 357 | WP_002994106.1 | hypothetical protein | - |
| JHX98_RS06005 (JHX98_06005) | - | 1169989..1170333 (-) | 345 | WP_011054690.1 | HNH endonuclease signature motif containing protein | - |
| JHX98_RS06010 (JHX98_06010) | - | 1170441..1170860 (-) | 420 | WP_011528791.1 | DUF1492 domain-containing protein | - |
| JHX98_RS06015 (JHX98_06015) | - | 1170936..1171187 (-) | 252 | WP_011054692.1 | hypothetical protein | - |
| JHX98_RS06020 (JHX98_06020) | - | 1171184..1171339 (-) | 156 | WP_011054693.1 | hypothetical protein | - |
| JHX98_RS06025 (JHX98_06025) | - | 1171336..1171653 (-) | 318 | WP_011054694.1 | DUF1372 family protein | - |
| JHX98_RS06030 (JHX98_06030) | - | 1171689..1172201 (-) | 513 | WP_011054695.1 | hypothetical protein | - |
| JHX98_RS06035 (JHX98_06035) | - | 1172198..1172530 (-) | 333 | WP_011184741.1 | hypothetical protein | - |
| JHX98_RS06040 (JHX98_06040) | - | 1172541..1173887 (-) | 1347 | WP_011054697.1 | PcfJ domain-containing protein | - |
| JHX98_RS06045 (JHX98_06045) | - | 1173884..1174279 (-) | 396 | WP_011054698.1 | Cas9 inhibitor AcrIIA9 family protein | - |
| JHX98_RS06050 (JHX98_06050) | - | 1174644..1175441 (-) | 798 | WP_011054699.1 | PD-(D/E)XK nuclease-like domain-containing protein | - |
| JHX98_RS06055 (JHX98_06055) | - | 1175434..1175634 (-) | 201 | WP_000594115.1 | hypothetical protein | - |
| JHX98_RS06060 (JHX98_06060) | - | 1175631..1176620 (-) | 990 | WP_010922474.1 | recombinase RecT | - |
| JHX98_RS06065 (JHX98_06065) | - | 1176620..1176952 (-) | 333 | WP_200274636.1 | hypothetical protein | - |
| JHX98_RS06070 (JHX98_06070) | - | 1177008..1177214 (-) | 207 | WP_002988357.1 | hypothetical protein | - |
| JHX98_RS06075 (JHX98_06075) | - | 1177223..1177363 (-) | 141 | WP_002988354.1 | hypothetical protein | - |
| JHX98_RS06080 (JHX98_06080) | - | 1177360..1177593 (-) | 234 | WP_010922205.1 | hypothetical protein | - |
| JHX98_RS06085 (JHX98_06085) | - | 1177574..1177960 (-) | 387 | WP_011017564.1 | DnaD domain-containing protein | - |
| JHX98_RS09660 | - | 1178101..1178370 (-) | 270 | WP_011106700.1 | replication protein | - |
| JHX98_RS06090 (JHX98_06090) | - | 1178464..1178649 (-) | 186 | WP_010922477.1 | hypothetical protein | - |
| JHX98_RS06095 (JHX98_06095) | - | 1178651..1178962 (-) | 312 | WP_010922478.1 | excisionase | - |
| JHX98_RS06100 (JHX98_06100) | - | 1179232..1179444 (-) | 213 | WP_010922479.1 | helix-turn-helix transcriptional regulator | - |
| JHX98_RS06105 (JHX98_06105) | - | 1179646..1180401 (+) | 756 | WP_010922480.1 | XRE family transcriptional regulator | - |
| JHX98_RS06110 (JHX98_06110) | - | 1180413..1180931 (+) | 519 | WP_011528799.1 | HIRAN domain-containing protein | - |
| JHX98_RS06115 (JHX98_06115) | - | 1181055..1182197 (+) | 1143 | WP_003051793.1 | site-specific integrase | - |
| JHX98_RS06120 (JHX98_06120) | - | 1182287..1182562 (-) | 276 | WP_002983920.1 | HU family DNA-binding protein | - |
| JHX98_RS06125 (JHX98_06125) | - | 1182661..1183248 (-) | 588 | WP_002989129.1 | YpmS family protein | - |
| JHX98_RS06130 (JHX98_06130) | - | 1183226..1184068 (-) | 843 | WP_011888746.1 | SGNH/GDSL hydrolase family protein | - |
| JHX98_RS06135 (JHX98_06135) | - | 1184061..1184900 (-) | 840 | WP_002989125.1 | DegV family protein | - |
| JHX98_RS06140 (JHX98_06140) | - | 1185128..1186066 (-) | 939 | WP_011888745.1 | LPXTG cell wall anchor domain-containing protein | - |
| JHX98_RS06145 (JHX98_06145) | recN | 1186238..1187899 (-) | 1662 | WP_011017995.1 | DNA repair protein RecN | - |
Sequence
Protein
Download Length: 60 a.a. Molecular weight: 6917.86 Da Isoelectric Point: 4.3455
>NTDB_id=524346 JHX98_RS05845 WP_011888783.1 1146438..1146620(-) (prx) [Streptococcus pyogenes strain iGAS376]
MLTYDEFKQAIDNGYITGDTVMIVRKNGQIFDYVLPHEKVKNGEVVTDEKVEEVLVELSR
MLTYDEFKQAIDNGYITGDTVMIVRKNGQIFDYVLPHEKVKNGEVVTDEKVEEVLVELSR
Nucleotide
Download Length: 183 bp
>NTDB_id=524346 JHX98_RS05845 WP_011888783.1 1146438..1146620(-) (prx) [Streptococcus pyogenes strain iGAS376]
ATGTTAACATACGATGAATTTAAGCAAGCGATTGACAATGGATATATCACAGGAGACACAGTTATGATCGTGCGTAAAAA
CGGACAGATTTTTGATTATGTTTTGCCACATGAGAAAGTAAAGAATGGAGAAGTTGTGACAGACGAAAAAGTGGAAGAGG
TGCTGGTGGAGCTTTCGAGATAA
ATGTTAACATACGATGAATTTAAGCAAGCGATTGACAATGGATATATCACAGGAGACACAGTTATGATCGTGCGTAAAAA
CGGACAGATTTTTGATTATGTTTTGCCACATGAGAAAGTAAAGAATGGAGAAGTTGTGACAGACGAAAAAGTGGAAGAGG
TGCTGGTGGAGCTTTCGAGATAA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS8232 |
93.333 |
100 |
0.933 |
| prx | Streptococcus pyogenes MGAS315 |
91.667 |
100 |
0.917 |
| prx | Streptococcus pyogenes MGAS315 |
81.667 |
100 |
0.817 |
| prx | Streptococcus pyogenes MGAS315 |
75 |
100 |
0.75 |
| prx | Streptococcus pyogenes MGAS315 |
88.372 |
71.667 |
0.633 |
| prx | Streptococcus pyogenes MGAS315 |
90.244 |
68.333 |
0.617 |
| prx | Streptococcus pyogenes MGAS315 |
78.571 |
70 |
0.55 |