Detailed information
Bioinformatically predicted
Overview
| Name | prx | Type | Regulator |
| Locus tag | JHX97_RS04045 | Genome accession | NZ_CP067009 |
| Coordinates | 742342..742524 (+) | Length | 60 a.a. |
| NCBI ID | WP_011888783.1 | Uniprot ID | - |
| Organism | Streptococcus pyogenes strain iGAS391 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 701126..742524 | 742342..742524 | within | 0 |
Gene organization within MGE regions
Location: 701126..742524
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| JHX97_RS03745 (JHX97_03745) | recN | 701126..702787 (+) | 1662 | WP_011017995.1 | DNA repair protein RecN | - |
| JHX97_RS03750 (JHX97_03750) | - | 702959..703897 (+) | 939 | WP_011888745.1 | LPXTG cell wall anchor domain-containing protein | - |
| JHX97_RS03755 (JHX97_03755) | - | 704125..704964 (+) | 840 | WP_002989125.1 | DegV family protein | - |
| JHX97_RS03760 (JHX97_03760) | - | 704957..705799 (+) | 843 | WP_011888746.1 | SGNH/GDSL hydrolase family protein | - |
| JHX97_RS03765 (JHX97_03765) | - | 705777..706364 (+) | 588 | WP_002989129.1 | YpmS family protein | - |
| JHX97_RS03770 (JHX97_03770) | - | 706463..706738 (+) | 276 | WP_002983920.1 | HU family DNA-binding protein | - |
| JHX97_RS03775 (JHX97_03775) | - | 706828..707970 (-) | 1143 | WP_003051793.1 | site-specific integrase | - |
| JHX97_RS03780 (JHX97_03780) | - | 708094..708612 (-) | 519 | WP_011528799.1 | HIRAN domain-containing protein | - |
| JHX97_RS03785 (JHX97_03785) | - | 708624..709379 (-) | 756 | WP_010922480.1 | XRE family transcriptional regulator | - |
| JHX97_RS03790 (JHX97_03790) | - | 709581..709793 (+) | 213 | WP_010922479.1 | helix-turn-helix transcriptional regulator | - |
| JHX97_RS03795 (JHX97_03795) | - | 710063..710374 (+) | 312 | WP_010922478.1 | excisionase | - |
| JHX97_RS03800 (JHX97_03800) | - | 710376..710561 (+) | 186 | WP_010922477.1 | hypothetical protein | - |
| JHX97_RS09625 | - | 710655..710924 (+) | 270 | WP_011106700.1 | replication protein | - |
| JHX97_RS03805 (JHX97_03805) | - | 711065..711451 (+) | 387 | WP_011017564.1 | DnaD domain-containing protein | - |
| JHX97_RS03810 (JHX97_03810) | - | 711432..711665 (+) | 234 | WP_010922205.1 | hypothetical protein | - |
| JHX97_RS03815 (JHX97_03815) | - | 711662..711802 (+) | 141 | WP_002988354.1 | hypothetical protein | - |
| JHX97_RS03820 (JHX97_03820) | - | 711811..712017 (+) | 207 | WP_002988357.1 | hypothetical protein | - |
| JHX97_RS03825 (JHX97_03825) | - | 712073..712402 (+) | 330 | WP_011528796.1 | hypothetical protein | - |
| JHX97_RS03830 (JHX97_03830) | - | 712405..713331 (+) | 927 | WP_011054700.1 | recombinase RecT | - |
| JHX97_RS03835 (JHX97_03835) | - | 713328..713528 (+) | 201 | WP_000594115.1 | hypothetical protein | - |
| JHX97_RS03840 (JHX97_03840) | - | 713521..714318 (+) | 798 | WP_011054699.1 | PD-(D/E)XK nuclease-like domain-containing protein | - |
| JHX97_RS03845 (JHX97_03845) | - | 714683..715078 (+) | 396 | WP_011054698.1 | Cas9 inhibitor AcrIIA9 family protein | - |
| JHX97_RS03850 (JHX97_03850) | - | 715075..716421 (+) | 1347 | WP_011054697.1 | PcfJ domain-containing protein | - |
| JHX97_RS03855 (JHX97_03855) | - | 716432..716764 (+) | 333 | WP_011184741.1 | hypothetical protein | - |
| JHX97_RS03860 (JHX97_03860) | - | 716761..717273 (+) | 513 | WP_011054695.1 | hypothetical protein | - |
| JHX97_RS03865 (JHX97_03865) | - | 717309..717626 (+) | 318 | WP_011054694.1 | DUF1372 family protein | - |
| JHX97_RS03870 (JHX97_03870) | - | 717623..717778 (+) | 156 | WP_011054693.1 | hypothetical protein | - |
| JHX97_RS03875 (JHX97_03875) | - | 717775..718026 (+) | 252 | WP_011054692.1 | hypothetical protein | - |
| JHX97_RS03880 (JHX97_03880) | - | 718102..718521 (+) | 420 | WP_011528791.1 | DUF1492 domain-containing protein | - |
| JHX97_RS03885 (JHX97_03885) | - | 718629..718973 (+) | 345 | WP_011054690.1 | HNH endonuclease signature motif containing protein | - |
| JHX97_RS03890 (JHX97_03890) | - | 719121..719477 (+) | 357 | WP_002994106.1 | hypothetical protein | - |
| JHX97_RS03895 (JHX97_03895) | - | 719474..720742 (+) | 1269 | WP_076640885.1 | phage portal protein | - |
| JHX97_RS03900 (JHX97_03900) | - | 720735..722228 (+) | 1494 | WP_011017978.1 | hypothetical protein | - |
| JHX97_RS03905 (JHX97_03905) | - | 722234..722458 (+) | 225 | WP_002994100.1 | hypothetical protein | - |
| JHX97_RS03910 (JHX97_03910) | - | 722535..722687 (+) | 153 | WP_011054687.1 | hypothetical protein | - |
| JHX97_RS03915 (JHX97_03915) | - | 722680..722946 (+) | 267 | WP_002986828.1 | hypothetical protein | - |
| JHX97_RS03920 (JHX97_03920) | - | 722948..723184 (+) | 237 | WP_011888764.1 | hypothetical protein | - |
| JHX97_RS03925 (JHX97_03925) | - | 723266..724681 (+) | 1416 | WP_011888765.1 | terminase | - |
| JHX97_RS03930 (JHX97_03930) | - | 724752..725213 (+) | 462 | WP_011888766.1 | DUF4355 domain-containing protein | - |
| JHX97_RS03935 (JHX97_03935) | - | 725238..726149 (+) | 912 | WP_011888767.1 | phage major capsid protein | - |
| JHX97_RS03940 (JHX97_03940) | - | 726149..726349 (+) | 201 | WP_010922460.1 | hypothetical protein | - |
| JHX97_RS03945 (JHX97_03945) | - | 726359..726781 (+) | 423 | WP_011054682.1 | phage Gp19/Gp15/Gp42 family protein | - |
| JHX97_RS03950 (JHX97_03950) | - | 726741..727079 (+) | 339 | WP_011054681.1 | hypothetical protein | - |
| JHX97_RS03955 (JHX97_03955) | - | 727072..727308 (+) | 237 | WP_000032787.1 | hypothetical protein | - |
| JHX97_RS03960 (JHX97_03960) | - | 727309..727644 (+) | 336 | WP_000573598.1 | hypothetical protein | - |
| JHX97_RS03965 (JHX97_03965) | - | 727656..728234 (+) | 579 | WP_011888768.1 | hypothetical protein | - |
| JHX97_RS03970 (JHX97_03970) | - | 728245..728508 (+) | 264 | WP_010922455.1 | hypothetical protein | - |
| JHX97_RS03975 (JHX97_03975) | - | 728523..728894 (+) | 372 | WP_011528785.1 | DUF5361 domain-containing protein | - |
| JHX97_RS03980 (JHX97_03980) | - | 728894..731251 (+) | 2358 | WP_011888769.1 | hypothetical protein | - |
| JHX97_RS03985 (JHX97_03985) | - | 731248..731943 (+) | 696 | WP_011888770.1 | hypothetical protein | - |
| JHX97_RS03990 (JHX97_03990) | - | 731925..733901 (+) | 1977 | WP_041174190.1 | phage tail spike protein | - |
| JHX97_RS03995 (JHX97_03995) | hylP | 733898..734914 (+) | 1017 | WP_072135668.1 | hyaluronidase HylP | - |
| JHX97_RS04000 (JHX97_04000) | - | 734929..736713 (+) | 1785 | WP_011888773.1 | gp58-like family protein | - |
| JHX97_RS04005 (JHX97_04005) | - | 736725..737153 (+) | 429 | WP_011888774.1 | DUF1617 family protein | - |
| JHX97_RS04010 (JHX97_04010) | - | 737156..737788 (+) | 633 | WP_011888775.1 | hypothetical protein | - |
| JHX97_RS04015 (JHX97_04015) | - | 737799..738098 (+) | 300 | WP_002988799.1 | hypothetical protein | - |
| JHX97_RS04020 (JHX97_04020) | - | 738095..738280 (+) | 186 | WP_011888776.1 | holin | - |
| JHX97_RS04025 (JHX97_04025) | - | 738394..739611 (+) | 1218 | WP_023077240.1 | peptidoglycan amidohydrolase family protein | - |
| JHX97_RS04030 (JHX97_04030) | - | 739905..740876 (+) | 972 | WP_011888780.1 | Abi family protein | - |
| JHX97_RS04035 (JHX97_04035) | - | 741060..741260 (+) | 201 | WP_011888781.1 | CsbD family protein | - |
| JHX97_RS04040 (JHX97_04040) | - | 741482..742276 (+) | 795 | WP_011888782.1 | DNA/RNA non-specific endonuclease | - |
| JHX97_RS04045 (JHX97_04045) | prx | 742342..742524 (+) | 183 | WP_011888783.1 | hypothetical protein | Regulator |
Sequence
Protein
Download Length: 60 a.a. Molecular weight: 6917.86 Da Isoelectric Point: 4.3455
>NTDB_id=524285 JHX97_RS04045 WP_011888783.1 742342..742524(+) (prx) [Streptococcus pyogenes strain iGAS391]
MLTYDEFKQAIDNGYITGDTVMIVRKNGQIFDYVLPHEKVKNGEVVTDEKVEEVLVELSR
MLTYDEFKQAIDNGYITGDTVMIVRKNGQIFDYVLPHEKVKNGEVVTDEKVEEVLVELSR
Nucleotide
Download Length: 183 bp
>NTDB_id=524285 JHX97_RS04045 WP_011888783.1 742342..742524(+) (prx) [Streptococcus pyogenes strain iGAS391]
ATGTTAACATACGATGAATTTAAGCAAGCGATTGACAATGGATATATCACAGGAGACACAGTTATGATCGTGCGTAAAAA
CGGACAGATTTTTGATTATGTTTTGCCACATGAGAAAGTAAAGAATGGAGAAGTTGTGACAGACGAAAAAGTGGAAGAGG
TGCTGGTGGAGCTTTCGAGATAA
ATGTTAACATACGATGAATTTAAGCAAGCGATTGACAATGGATATATCACAGGAGACACAGTTATGATCGTGCGTAAAAA
CGGACAGATTTTTGATTATGTTTTGCCACATGAGAAAGTAAAGAATGGAGAAGTTGTGACAGACGAAAAAGTGGAAGAGG
TGCTGGTGGAGCTTTCGAGATAA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS8232 |
93.333 |
100 |
0.933 |
| prx | Streptococcus pyogenes MGAS315 |
91.667 |
100 |
0.917 |
| prx | Streptococcus pyogenes MGAS315 |
81.667 |
100 |
0.817 |
| prx | Streptococcus pyogenes MGAS315 |
75 |
100 |
0.75 |
| prx | Streptococcus pyogenes MGAS315 |
88.372 |
71.667 |
0.633 |
| prx | Streptococcus pyogenes MGAS315 |
90.244 |
68.333 |
0.617 |
| prx | Streptococcus pyogenes MGAS315 |
78.571 |
70 |
0.55 |