Detailed information
Bioinformatically predicted
Overview
| Name | prx | Type | Regulator |
| Locus tag | JCR30_RS04045 | Genome accession | NZ_CP067008 |
| Coordinates | 742406..742588 (+) | Length | 60 a.a. |
| NCBI ID | WP_011888783.1 | Uniprot ID | - |
| Organism | Streptococcus pyogenes strain iGAS426 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 704940..742588 | 742406..742588 | within | 0 |
Gene organization within MGE regions
Location: 704940..742588
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| JCR30_RS03760 (JCR30_03760) | - | 704958..705800 (+) | 843 | WP_011888746.1 | SGNH/GDSL hydrolase family protein | - |
| JCR30_RS03765 (JCR30_03765) | - | 705778..706365 (+) | 588 | WP_002989129.1 | YpmS family protein | - |
| JCR30_RS03770 (JCR30_03770) | - | 706464..706739 (+) | 276 | WP_002983920.1 | HU family DNA-binding protein | - |
| JCR30_RS03775 (JCR30_03775) | - | 706829..707971 (-) | 1143 | WP_003051793.1 | site-specific integrase | - |
| JCR30_RS03780 (JCR30_03780) | - | 708095..708613 (-) | 519 | WP_011528799.1 | HIRAN domain-containing protein | - |
| JCR30_RS03785 (JCR30_03785) | - | 708625..709380 (-) | 756 | WP_010922480.1 | XRE family transcriptional regulator | - |
| JCR30_RS03790 (JCR30_03790) | - | 709582..709794 (+) | 213 | WP_010922479.1 | helix-turn-helix transcriptional regulator | - |
| JCR30_RS03795 (JCR30_03795) | - | 710064..710375 (+) | 312 | WP_010922478.1 | excisionase | - |
| JCR30_RS03800 (JCR30_03800) | - | 710377..710562 (+) | 186 | WP_010922477.1 | hypothetical protein | - |
| JCR30_RS09625 | - | 710656..710925 (+) | 270 | WP_011106700.1 | replication protein | - |
| JCR30_RS03805 (JCR30_03805) | - | 711066..711452 (+) | 387 | WP_011017564.1 | DnaD domain-containing protein | - |
| JCR30_RS03810 (JCR30_03810) | - | 711433..711666 (+) | 234 | WP_010922205.1 | hypothetical protein | - |
| JCR30_RS03815 (JCR30_03815) | - | 711663..711803 (+) | 141 | WP_002988354.1 | hypothetical protein | - |
| JCR30_RS03820 (JCR30_03820) | - | 711812..712018 (+) | 207 | WP_002988357.1 | hypothetical protein | - |
| JCR30_RS03825 (JCR30_03825) | - | 712074..712406 (+) | 333 | WP_200274636.1 | hypothetical protein | - |
| JCR30_RS03830 (JCR30_03830) | - | 712406..713395 (+) | 990 | WP_010922474.1 | recombinase RecT | - |
| JCR30_RS03835 (JCR30_03835) | - | 713392..713592 (+) | 201 | WP_000594115.1 | hypothetical protein | - |
| JCR30_RS03840 (JCR30_03840) | - | 713585..714382 (+) | 798 | WP_011054699.1 | PD-(D/E)XK nuclease-like domain-containing protein | - |
| JCR30_RS03845 (JCR30_03845) | - | 714747..715142 (+) | 396 | WP_011054698.1 | Cas9 inhibitor AcrIIA9 family protein | - |
| JCR30_RS03850 (JCR30_03850) | - | 715139..716485 (+) | 1347 | WP_011054697.1 | PcfJ domain-containing protein | - |
| JCR30_RS03855 (JCR30_03855) | - | 716496..716828 (+) | 333 | WP_011184741.1 | hypothetical protein | - |
| JCR30_RS03860 (JCR30_03860) | - | 716825..717337 (+) | 513 | WP_011054695.1 | hypothetical protein | - |
| JCR30_RS03865 (JCR30_03865) | - | 717373..717690 (+) | 318 | WP_011054694.1 | DUF1372 family protein | - |
| JCR30_RS03870 (JCR30_03870) | - | 717687..717842 (+) | 156 | WP_011054693.1 | hypothetical protein | - |
| JCR30_RS03875 (JCR30_03875) | - | 717839..718090 (+) | 252 | WP_011054692.1 | hypothetical protein | - |
| JCR30_RS03880 (JCR30_03880) | - | 718166..718585 (+) | 420 | WP_011528791.1 | DUF1492 domain-containing protein | - |
| JCR30_RS03885 (JCR30_03885) | - | 718693..719037 (+) | 345 | WP_011054690.1 | HNH endonuclease signature motif containing protein | - |
| JCR30_RS03890 (JCR30_03890) | - | 719185..719541 (+) | 357 | WP_002994106.1 | hypothetical protein | - |
| JCR30_RS03895 (JCR30_03895) | - | 719538..720806 (+) | 1269 | WP_076640885.1 | phage portal protein | - |
| JCR30_RS03900 (JCR30_03900) | - | 720799..722292 (+) | 1494 | WP_011017978.1 | hypothetical protein | - |
| JCR30_RS03905 (JCR30_03905) | - | 722298..722522 (+) | 225 | WP_002994100.1 | hypothetical protein | - |
| JCR30_RS03910 (JCR30_03910) | - | 722599..722751 (+) | 153 | WP_011054687.1 | hypothetical protein | - |
| JCR30_RS03915 (JCR30_03915) | - | 722744..723010 (+) | 267 | WP_002986828.1 | hypothetical protein | - |
| JCR30_RS03920 (JCR30_03920) | - | 723012..723248 (+) | 237 | WP_011888764.1 | hypothetical protein | - |
| JCR30_RS03925 (JCR30_03925) | - | 723330..724745 (+) | 1416 | WP_011888765.1 | terminase | - |
| JCR30_RS03930 (JCR30_03930) | - | 724816..725277 (+) | 462 | WP_011888766.1 | DUF4355 domain-containing protein | - |
| JCR30_RS03935 (JCR30_03935) | - | 725302..726213 (+) | 912 | WP_011888767.1 | phage major capsid protein | - |
| JCR30_RS03940 (JCR30_03940) | - | 726213..726413 (+) | 201 | WP_010922460.1 | hypothetical protein | - |
| JCR30_RS03945 (JCR30_03945) | - | 726423..726845 (+) | 423 | WP_011054682.1 | phage Gp19/Gp15/Gp42 family protein | - |
| JCR30_RS03950 (JCR30_03950) | - | 726805..727143 (+) | 339 | WP_011054681.1 | hypothetical protein | - |
| JCR30_RS03955 (JCR30_03955) | - | 727136..727372 (+) | 237 | WP_000032787.1 | hypothetical protein | - |
| JCR30_RS03960 (JCR30_03960) | - | 727373..727708 (+) | 336 | WP_000573598.1 | hypothetical protein | - |
| JCR30_RS03965 (JCR30_03965) | - | 727720..728298 (+) | 579 | WP_011888768.1 | hypothetical protein | - |
| JCR30_RS03970 (JCR30_03970) | - | 728309..728572 (+) | 264 | WP_010922455.1 | hypothetical protein | - |
| JCR30_RS03975 (JCR30_03975) | - | 728587..728958 (+) | 372 | WP_011528785.1 | DUF5361 domain-containing protein | - |
| JCR30_RS03980 (JCR30_03980) | - | 728958..731315 (+) | 2358 | WP_011888769.1 | hypothetical protein | - |
| JCR30_RS03985 (JCR30_03985) | - | 731312..732007 (+) | 696 | WP_011888770.1 | hypothetical protein | - |
| JCR30_RS03990 (JCR30_03990) | - | 731989..733965 (+) | 1977 | WP_041174190.1 | phage tail spike protein | - |
| JCR30_RS03995 (JCR30_03995) | hylP | 733962..734978 (+) | 1017 | WP_072135668.1 | hyaluronidase HylP | - |
| JCR30_RS04000 (JCR30_04000) | - | 734993..736777 (+) | 1785 | WP_011888773.1 | gp58-like family protein | - |
| JCR30_RS04005 (JCR30_04005) | - | 736789..737217 (+) | 429 | WP_011888774.1 | DUF1617 family protein | - |
| JCR30_RS04010 (JCR30_04010) | - | 737220..737852 (+) | 633 | WP_011888775.1 | hypothetical protein | - |
| JCR30_RS04015 (JCR30_04015) | - | 737863..738162 (+) | 300 | WP_002988799.1 | hypothetical protein | - |
| JCR30_RS04020 (JCR30_04020) | - | 738159..738344 (+) | 186 | WP_011888776.1 | holin | - |
| JCR30_RS04025 (JCR30_04025) | - | 738458..739675 (+) | 1218 | WP_023077240.1 | peptidoglycan amidohydrolase family protein | - |
| JCR30_RS04030 (JCR30_04030) | - | 739969..740940 (+) | 972 | WP_011888780.1 | Abi family protein | - |
| JCR30_RS04035 (JCR30_04035) | - | 741124..741324 (+) | 201 | WP_011888781.1 | CsbD family protein | - |
| JCR30_RS04040 (JCR30_04040) | - | 741546..742340 (+) | 795 | WP_011888782.1 | DNA/RNA non-specific endonuclease | - |
| JCR30_RS04045 (JCR30_04045) | prx | 742406..742588 (+) | 183 | WP_011888783.1 | hypothetical protein | Regulator |
Sequence
Protein
Download Length: 60 a.a. Molecular weight: 6917.86 Da Isoelectric Point: 4.3455
>NTDB_id=524229 JCR30_RS04045 WP_011888783.1 742406..742588(+) (prx) [Streptococcus pyogenes strain iGAS426]
MLTYDEFKQAIDNGYITGDTVMIVRKNGQIFDYVLPHEKVKNGEVVTDEKVEEVLVELSR
MLTYDEFKQAIDNGYITGDTVMIVRKNGQIFDYVLPHEKVKNGEVVTDEKVEEVLVELSR
Nucleotide
Download Length: 183 bp
>NTDB_id=524229 JCR30_RS04045 WP_011888783.1 742406..742588(+) (prx) [Streptococcus pyogenes strain iGAS426]
ATGTTAACATACGATGAATTTAAGCAAGCGATTGACAATGGATATATCACAGGAGACACAGTTATGATCGTGCGTAAAAA
CGGACAGATTTTTGATTATGTTTTGCCACATGAGAAAGTAAAGAATGGAGAAGTTGTGACAGACGAAAAAGTGGAAGAGG
TGCTGGTGGAGCTTTCGAGATAA
ATGTTAACATACGATGAATTTAAGCAAGCGATTGACAATGGATATATCACAGGAGACACAGTTATGATCGTGCGTAAAAA
CGGACAGATTTTTGATTATGTTTTGCCACATGAGAAAGTAAAGAATGGAGAAGTTGTGACAGACGAAAAAGTGGAAGAGG
TGCTGGTGGAGCTTTCGAGATAA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS8232 |
93.333 |
100 |
0.933 |
| prx | Streptococcus pyogenes MGAS315 |
91.667 |
100 |
0.917 |
| prx | Streptococcus pyogenes MGAS315 |
81.667 |
100 |
0.817 |
| prx | Streptococcus pyogenes MGAS315 |
75 |
100 |
0.75 |
| prx | Streptococcus pyogenes MGAS315 |
88.372 |
71.667 |
0.633 |
| prx | Streptococcus pyogenes MGAS315 |
90.244 |
68.333 |
0.617 |
| prx | Streptococcus pyogenes MGAS315 |
78.571 |
70 |
0.55 |