Detailed information
Overview
| Name | comC/comC1 | Type | Regulator |
| Locus tag | I6H77_RS04200 | Genome accession | NZ_CP066021 |
| Coordinates | 854721..854846 (+) | Length | 41 a.a. |
| NCBI ID | WP_002874960.1 | Uniprot ID | O33689 |
| Organism | Streptococcus oralis strain FDAARGOS_1020 | ||
| Function | binding to ComD; induce autophosphorylation of ComD (predicted from homology) Competence regulation |
||
Genomic Context
Location: 849721..859846
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| I6H77_RS04175 (I6H77_04175) | dnaA | 850184..851545 (-) | 1362 | WP_000660625.1 | chromosomal replication initiator protein DnaA | - |
| I6H77_RS04180 (I6H77_04180) | spo0J | 851762..852520 (-) | 759 | WP_000410357.1 | ParB/RepB/Spo0J family partition protein | Regulator |
| I6H77_RS04185 (I6H77_04185) | htrA | 852578..853774 (-) | 1197 | WP_000681805.1 | S1C family serine protease | Regulator |
| I6H77_RS04190 (I6H77_04190) | rlmH | 853960..854439 (+) | 480 | WP_000694221.1 | 23S rRNA (pseudouridine(1915)-N(3))-methyltransferase RlmH | - |
| I6H77_RS04200 (I6H77_04200) | comC/comC1 | 854721..854846 (+) | 126 | WP_002874960.1 | competence-stimulating peptide ComC | Regulator |
| I6H77_RS04205 (I6H77_04205) | comD | 854867..856186 (+) | 1320 | WP_000054555.1 | competence system sensor histidine kinase ComD | Regulator |
| I6H77_RS04210 (I6H77_04210) | comE | 856183..856935 (+) | 753 | WP_000866079.1 | competence system response regulator transcription factor ComE | Regulator |
| I6H77_RS04225 (I6H77_04225) | - | 857173..857715 (-) | 543 | WP_000665080.1 | TetR/AcrR family transcriptional regulator | - |
Sequence
Protein
Download Length: 41 a.a. Molecular weight: 4987.71 Da Isoelectric Point: 9.8680
>NTDB_id=516468 I6H77_RS04200 WP_002874960.1 854721..854846(+) (comC/comC1) [Streptococcus oralis strain FDAARGOS_1020]
MKNTEKLEQFKEVTEAELQEIRGGDKRLPYFFKHLFSNRTK
MKNTEKLEQFKEVTEAELQEIRGGDKRLPYFFKHLFSNRTK
Nucleotide
Download Length: 126 bp
>NTDB_id=516468 I6H77_RS04200 WP_002874960.1 854721..854846(+) (comC/comC1) [Streptococcus oralis strain FDAARGOS_1020]
ATGAAAAATACAGAAAAGTTGGAACAATTTAAAGAAGTAACAGAGGCAGAATTGCAGGAGATTCGAGGTGGAGATAAAAG
ACTACCTTACTTTTTTAAACATCTTTTTTCAAATAGGACAAAGTAG
ATGAAAAATACAGAAAAGTTGGAACAATTTAAAGAAGTAACAGAGGCAGAATTGCAGGAGATTCGAGGTGGAGATAAAAG
ACTACCTTACTTTTTTAAACATCTTTTTTCAAATAGGACAAAGTAG
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comC/comC1 | Streptococcus pneumoniae R6 |
51.22 |
100 |
0.512 |
| comC/comC1 | Streptococcus pneumoniae G54 |
51.22 |
100 |
0.512 |
| comC/comC1 | Streptococcus pneumoniae D39 |
51.22 |
100 |
0.512 |
| comC/comC1 | Streptococcus pneumoniae Rx1 |
51.22 |
100 |
0.512 |
| comC | Streptococcus mitis SK321 |
65.517 |
70.732 |
0.463 |
| comC/comC2 | Streptococcus pneumoniae A66 |
55.172 |
70.732 |
0.39 |
| comC/comC2 | Streptococcus pneumoniae TIGR4 |
55.172 |
70.732 |
0.39 |
| comC/blpC | Streptococcus mutans UA159 |
44.118 |
82.927 |
0.366 |