Detailed information NTG0515733

Bioinformatically predicted

Overview

• Name: comGC
• Type: Machinery gene
• Locus tag: JCQ35_RS03715
• Genome accession: NZ_CP065960
• Coordinates: 687660..687977 (+)
• Length: 105 a.a.
• NCBI ID: WP_037588275.1
• Uniprot ID: -
• Organism: Mammaliicoccus sciuri strain GDK8D55P
• Function: dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 682660..692977

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
JCQ35_RS03675 (JCQ35_03675)	-	682803..682991 (+)	189	WP_198472064.1	YqgQ family protein	-
JCQ35_RS03680 (JCQ35_03680)	-	682991..683962 (+)	972	WP_204257909.1	ROK family glucokinase	-
JCQ35_RS03685 (JCQ35_03685)	-	683962..684276 (+)	315	WP_037588286.1	MTH1187 family thiamine-binding protein	-
JCQ35_RS03690 (JCQ35_03690)	-	684306..684545 (-)	240	WP_016911885.1	DUF2759 domain-containing protein	-
JCQ35_RS03695 (JCQ35_03695)	-	684643..685275 (+)	633	WP_037588281.1	MBL fold metallo-hydrolase	-
JCQ35_RS03700 (JCQ35_03700)	-	685310..685558 (-)	249	WP_025904960.1	DUF2626 family protein	-
JCQ35_RS03705 (JCQ35_03705)	comGA	685712..686614 (+)	903	WP_198472065.1	competence type IV pilus ATPase ComGA	-
JCQ35_RS03710 (JCQ35_03710)	comGB	686604..687644 (+)	1041	WP_198472066.1	competence type IV pilus assembly protein ComGB	-
JCQ35_RS03715 (JCQ35_03715)	comGC	687660..687977 (+)	318	WP_037588275.1	competence type IV pilus major pilin ComGC	Machinery gene
JCQ35_RS03720 (JCQ35_03720)	-	688006..688404 (+)	399	WP_232624091.1	prepilin-type cleavage/methylation domain-containing protein	-
JCQ35_RS03725 (JCQ35_03725)	comGE	688388..688669 (+)	282	WP_107578103.1	competence type IV pilus minor pilin ComGE	-
JCQ35_RS03730 (JCQ35_03730)	comGF	688644..689078 (+)	435	WP_198472067.1	competence type IV pilus minor pilin ComGF	-
JCQ35_RS03735 (JCQ35_03735)	-	689313..689801 (+)	489	WP_037588260.1	shikimate kinase	-
JCQ35_RS03740 (JCQ35_03740)	gcvT	689995..691083 (+)	1089	WP_198472068.1	glycine cleavage system aminomethyltransferase GcvT	-
JCQ35_RS03745 (JCQ35_03745)	gcvPA	691095..692438 (+)	1344	WP_198472069.1	aminomethyl-transferring glycine dehydrogenase subunit GcvPA	-

Sequence

Protein

• Length: 105 a.a.
• Molecular weight: 11591.65 Da
• Isoelectric Point: 8.5043

>NTDB_id=515733 JCQ35_RS03715 WP_037588275.1 687660..687977(+) (comGC) [Mammaliicoccus sciuri strain GDK8D55P]
MKRFKFLSKKEGFTLVEMLIVLLIISILLVIIIPNISKQSETVKSTGCQAQVKMVAGQVEAYTLKHDAKPNSINDLVSDG
YINQKQLTCKSGETITLENGEVVAH

Nucleotide

• Length: 318 bp

>NTDB_id=515733 JCQ35_RS03715 WP_037588275.1 687660..687977(+) (comGC) [Mammaliicoccus sciuri strain GDK8D55P]
ATGAAAAGATTTAAATTTTTAAGTAAAAAAGAAGGATTTACATTGGTAGAGATGCTAATAGTTCTTTTAATAATAAGTAT
ATTATTGGTGATCATCATACCAAACATAAGTAAGCAATCAGAGACGGTAAAAAGTACTGGATGCCAAGCTCAAGTGAAGA
TGGTTGCTGGACAAGTAGAAGCTTATACATTGAAGCACGATGCTAAACCAAATTCTATAAATGATTTAGTAAGTGATGGT
TATATTAATCAAAAGCAACTGACATGTAAATCAGGTGAAACAATTACACTTGAAAATGGTGAAGTTGTTGCACATTAA

Domains

Predicted by InterproScan.

• Prokaryotic N-terminal methylation motif (N_methyl) (8-32)

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comGC	Staphylococcus aureus N315	64.706	97.143	0.629
comGC	Staphylococcus aureus MW2	64.706	97.143	0.629
comGC	Bacillus subtilis subsp. subtilis str. 168	47.312	88.571	0.419
comYC	Streptococcus mutans UA159	49.425	82.857	0.41
comYC	Streptococcus mutans UA140	49.425	82.857	0.41
comYC	Streptococcus gordonii str. Challis substr. CH1	48.837	81.905	0.4
comGC/cglC	Streptococcus mitis NCTC 12261	46.988	79.048	0.371
comGC/cglC	Streptococcus mitis SK321	46.988	79.048	0.371
comGC	Lactococcus lactis subsp. cremoris KW2	46.914	77.143	0.362
comYC	Streptococcus suis isolate S10	48.718	74.286	0.362