Detailed information
Bioinformatically predicted
Overview
| Name | prx | Type | Regulator |
| Locus tag | JAN99_RS03560 | Genome accession | NZ_CP065927 |
| Coordinates | 692204..692386 (+) | Length | 60 a.a. |
| NCBI ID | WP_011017964.1 | Uniprot ID | - |
| Organism | Streptococcus pyogenes strain emm9ST603 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 647062..693349 | 692204..692386 | within | 0 |
| IScluster/Tn | 692570..693675 | 692204..692386 | flank | 184 |
Gene organization within MGE regions
Location: 647062..693675
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| JAN99_RS03250 (JAN99_03245) | - | 647080..647922 (+) | 843 | WP_161230208.1 | SGNH/GDSL hydrolase family protein | - |
| JAN99_RS03255 (JAN99_03250) | - | 647900..648487 (+) | 588 | WP_002989129.1 | YpmS family protein | - |
| JAN99_RS03260 (JAN99_03255) | - | 648586..648861 (+) | 276 | WP_002983920.1 | HU family DNA-binding protein | - |
| JAN99_RS03265 (JAN99_03260) | - | 648951..650092 (-) | 1142 | Protein_583 | site-specific integrase | - |
| JAN99_RS03270 (JAN99_03265) | - | 650219..650743 (-) | 525 | WP_048327221.1 | type II toxin-antitoxin system VapC family toxin | - |
| JAN99_RS03275 (JAN99_03270) | - | 650733..651077 (-) | 345 | WP_048327223.1 | STAS-like domain-containing protein | - |
| JAN99_RS03280 (JAN99_03275) | - | 651088..652011 (-) | 924 | WP_136020125.1 | hypothetical protein | - |
| JAN99_RS03285 (JAN99_03280) | - | 652038..652424 (-) | 387 | WP_136020124.1 | ImmA/IrrE family metallo-endopeptidase | - |
| JAN99_RS03290 (JAN99_03285) | - | 652428..652775 (-) | 348 | WP_136020123.1 | helix-turn-helix transcriptional regulator | - |
| JAN99_RS03295 (JAN99_03290) | - | 653064..653276 (+) | 213 | WP_003051787.1 | helix-turn-helix transcriptional regulator | - |
| JAN99_RS03300 (JAN99_03295) | - | 653289..654050 (+) | 762 | WP_136020122.1 | phage antirepressor KilAC domain-containing protein | - |
| JAN99_RS03305 (JAN99_03300) | - | 654082..654348 (+) | 267 | WP_010922204.1 | hypothetical protein | - |
| JAN99_RS03310 (JAN99_03305) | - | 654283..655089 (-) | 807 | WP_011285629.1 | TIGR02391 family protein | - |
| JAN99_RS03315 (JAN99_03310) | - | 655231..655470 (-) | 240 | WP_011284879.1 | hypothetical protein | - |
| JAN99_RS03320 (JAN99_03315) | - | 655637..655822 (+) | 186 | WP_011054585.1 | helix-turn-helix transcriptional regulator | - |
| JAN99_RS03325 (JAN99_03320) | - | 655900..656211 (+) | 312 | WP_002990080.1 | hypothetical protein | - |
| JAN99_RS03330 (JAN99_03325) | - | 656213..656398 (+) | 186 | WP_002990078.1 | hypothetical protein | - |
| JAN99_RS09100 | - | 656498..656737 (+) | 240 | WP_002985390.1 | hypothetical protein | - |
| JAN99_RS03335 (JAN99_03330) | - | 656867..657256 (+) | 390 | WP_011285627.1 | DnaD domain protein | - |
| JAN99_RS03340 (JAN99_03335) | - | 657237..657470 (+) | 234 | WP_002985387.1 | hypothetical protein | - |
| JAN99_RS03345 (JAN99_03340) | - | 657467..657607 (+) | 141 | WP_011017992.1 | hypothetical protein | - |
| JAN99_RS03350 (JAN99_03345) | - | 657616..657822 (+) | 207 | WP_011017565.1 | hypothetical protein | - |
| JAN99_RS03355 (JAN99_03350) | - | 657878..658207 (+) | 330 | WP_011017991.1 | hypothetical protein | - |
| JAN99_RS03360 (JAN99_03355) | - | 658210..659139 (+) | 930 | WP_053308489.1 | recombinase RecT | - |
| JAN99_RS03365 (JAN99_03360) | - | 659136..659933 (+) | 798 | WP_011017989.1 | PD-(D/E)XK nuclease-like domain-containing protein | - |
| JAN99_RS03370 (JAN99_03365) | - | 659943..660110 (+) | 168 | WP_011017988.1 | hypothetical protein | - |
| JAN99_RS03375 (JAN99_03370) | - | 660288..660629 (+) | 342 | WP_168641531.1 | hypothetical protein | - |
| JAN99_RS03380 (JAN99_03375) | - | 660626..661138 (+) | 513 | WP_136116288.1 | crossover junction endodeoxyribonuclease RuvC | - |
| JAN99_RS09105 | - | 661125..661310 (+) | 186 | WP_011017985.1 | hypothetical protein | - |
| JAN99_RS03385 (JAN99_03380) | - | 661315..661485 (+) | 171 | WP_168641525.1 | hypothetical protein | - |
| JAN99_RS03390 (JAN99_03385) | - | 661525..661965 (+) | 441 | WP_136116290.1 | ArpU family phage packaging/lysis transcriptional regulator | - |
| JAN99_RS03395 (JAN99_03390) | - | 662300..662509 (-) | 210 | WP_136116292.1 | hypothetical protein | - |
| JAN99_RS03400 (JAN99_03395) | - | 662585..663751 (+) | 1167 | WP_136116293.1 | DNA modification methylase | - |
| JAN99_RS03405 (JAN99_03400) | - | 664094..664570 (+) | 477 | WP_010922073.1 | hypothetical protein | - |
| JAN99_RS03410 (JAN99_03405) | - | 664653..665849 (+) | 1197 | WP_136116295.1 | PBSX family phage terminase large subunit | - |
| JAN99_RS03420 (JAN99_03415) | - | 667099..668602 (+) | 1504 | Protein_616 | phage portal protein | - |
| JAN99_RS03425 (JAN99_03420) | - | 668607..670100 (+) | 1494 | WP_198463012.1 | phage minor capsid protein | - |
| JAN99_RS03430 (JAN99_03425) | - | 670100..670327 (+) | 228 | WP_010922077.1 | hypothetical protein | - |
| JAN99_RS03435 (JAN99_03430) | - | 670414..670680 (+) | 267 | WP_010922078.1 | hypothetical protein | - |
| JAN99_RS03440 (JAN99_03435) | - | 670806..671420 (+) | 615 | WP_010922079.1 | hypothetical protein | - |
| JAN99_RS03445 (JAN99_03440) | - | 671424..672242 (+) | 819 | WP_010922080.1 | N4-gp56 family major capsid protein | - |
| JAN99_RS03450 (JAN99_03445) | - | 672296..672712 (+) | 417 | WP_011018123.1 | hypothetical protein | - |
| JAN99_RS03455 (JAN99_03450) | - | 672702..673034 (+) | 333 | WP_010922082.1 | minor capsid protein | - |
| JAN99_RS03460 (JAN99_03455) | - | 673034..673390 (+) | 357 | WP_010922083.1 | minor capsid protein | - |
| JAN99_RS03465 (JAN99_03460) | - | 673387..673785 (+) | 399 | WP_010922084.1 | minor capsid protein | - |
| JAN99_RS03470 (JAN99_03465) | - | 673785..674270 (+) | 486 | WP_136116390.1 | phage tail protein | - |
| JAN99_RS03475 (JAN99_03470) | - | 674309..674743 (+) | 435 | WP_010922086.1 | hypothetical protein | - |
| JAN99_RS03480 (JAN99_03475) | - | 674747..675328 (+) | 582 | WP_136116392.1 | bacteriophage Gp15 family protein | - |
| JAN99_RS03485 (JAN99_03480) | - | 675318..678578 (+) | 3261 | WP_136116394.1 | tape measure protein | - |
| JAN99_RS03490 (JAN99_03485) | - | 678575..679291 (+) | 717 | WP_011054737.1 | distal tail protein Dit | - |
| JAN99_RS03495 (JAN99_03490) | - | 679288..681432 (+) | 2145 | WP_136116396.1 | phage tail spike protein | - |
| JAN99_RS03500 (JAN99_03495) | hylP | 681429..682442 (+) | 1014 | WP_032461631.1 | hyaluronidase HylP | - |
| JAN99_RS03505 (JAN99_03500) | - | 682457..684340 (+) | 1884 | WP_136022513.1 | gp58-like family protein | - |
| JAN99_RS03510 (JAN99_03505) | - | 684352..684789 (+) | 438 | WP_015898602.1 | DUF1617 family protein | - |
| JAN99_RS03515 (JAN99_03510) | - | 684786..685397 (+) | 612 | WP_136022511.1 | DUF1366 domain-containing protein | - |
| JAN99_RS03520 (JAN99_03515) | - | 685407..685862 (+) | 456 | WP_011184730.1 | phage holin family protein | - |
| JAN99_RS03525 (JAN99_03520) | - | 685974..686525 (+) | 552 | Protein_637 | glycoside hydrolase family 73 protein | - |
| JAN99_RS03530 (JAN99_03525) | - | 686761..687453 (+) | 693 | WP_002994484.1 | AP2 domain-containing protein | - |
| JAN99_RS03535 (JAN99_03530) | - | 687566..688207 (+) | 642 | Protein_639 | CHAP domain-containing protein | - |
| JAN99_RS03540 (JAN99_03535) | - | 688347..688871 (+) | 525 | WP_011017840.1 | type II toxin-antitoxin system antitoxin SocA domain-containing protein | - |
| JAN99_RS03545 (JAN99_03540) | - | 688859..689725 (+) | 867 | WP_136022508.1 | DUF334 domain-containing protein | - |
| JAN99_RS03550 (JAN99_03545) | spek | 690028..690807 (+) | 780 | WP_011054728.1 | streptococcal pyrogenic exotoxin SpeK | - |
| JAN99_RS03555 (JAN99_03550) | - | 691283..691858 (+) | 576 | WP_011054727.1 | hypothetical protein | - |
| JAN99_RS09110 | - | 691852..692139 (+) | 288 | WP_011106694.1 | hypothetical protein | - |
| JAN99_RS03560 (JAN99_03555) | prx | 692204..692386 (+) | 183 | WP_011017964.1 | hypothetical protein | Regulator |
Sequence
Protein
Download Length: 60 a.a. Molecular weight: 6841.79 Da Isoelectric Point: 4.5183
>NTDB_id=515366 JAN99_RS03560 WP_011017964.1 692204..692386(+) (prx) [Streptococcus pyogenes strain emm9ST603]
MLTYDEFKQAIDNGYIAGDTVAIVRKDGQIFDYVLPHEKVKNGEVVTKEKVEEVLVELSR
MLTYDEFKQAIDNGYIAGDTVAIVRKDGQIFDYVLPHEKVKNGEVVTKEKVEEVLVELSR
Nucleotide
Download Length: 183 bp
>NTDB_id=515366 JAN99_RS03560 WP_011017964.1 692204..692386(+) (prx) [Streptococcus pyogenes strain emm9ST603]
ATGCTAACATACGACGAGTTTAAGCAAGCGATTGACAATGGATATATCGCAGGCGATACAGTAGCGATCGTGCGTAAAGA
CGGACAGATTTTTGATTATGTGTTGCCACATGAGAAAGTAAAGAATGGAGAAGTTGTGACTAAGGAAAAAGTGGAAGAGG
TGCTGGTGGAGCTTTCGAGATAA
ATGCTAACATACGACGAGTTTAAGCAAGCGATTGACAATGGATATATCGCAGGCGATACAGTAGCGATCGTGCGTAAAGA
CGGACAGATTTTTGATTATGTGTTGCCACATGAGAAAGTAAAGAATGGAGAAGTTGTGACTAAGGAAAAAGTGGAAGAGG
TGCTGGTGGAGCTTTCGAGATAA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS8232 |
100 |
100 |
1 |
| prx | Streptococcus pyogenes MGAS315 |
85 |
100 |
0.85 |
| prx | Streptococcus pyogenes MGAS315 |
80 |
100 |
0.8 |
| prx | Streptococcus pyogenes MGAS315 |
73.333 |
100 |
0.733 |
| prx | Streptococcus pyogenes MGAS315 |
90.244 |
68.333 |
0.617 |
| prx | Streptococcus pyogenes MGAS315 |
83.721 |
71.667 |
0.6 |
| prx | Streptococcus pyogenes MGAS315 |
78.571 |
70 |
0.55 |