Detailed information
Overview
| Name | prx | Type | Regulator |
| Locus tag | ST4147_RS00375 | Genome accession | NZ_CP065504 |
| Coordinates | 62963..63148 (+) | Length | 61 a.a. |
| NCBI ID | WP_347229955.1 | Uniprot ID | - |
| Organism | Streptococcus thermophilus strain 4147 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 53449..63148 | 62963..63148 | within | 0 |
Gene organization within MGE regions
Location: 53449..63148
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ST4147_RS00305 (ST4147_00305) | - | 53449..54615 (-) | 1167 | WP_347229946.1 | site-specific integrase | - |
| ST4147_RS00310 (ST4147_00310) | - | 54690..55256 (-) | 567 | WP_347229947.1 | helix-turn-helix transcriptional regulator | - |
| ST4147_RS00315 (ST4147_00315) | - | 55419..55616 (+) | 198 | WP_195950471.1 | helix-turn-helix transcriptional regulator | - |
| ST4147_RS00320 (ST4147_00320) | - | 55873..56175 (+) | 303 | WP_347229948.1 | hypothetical protein | - |
| ST4147_RS00325 (ST4147_00325) | - | 56180..56320 (+) | 141 | WP_347229949.1 | hypothetical protein | - |
| ST4147_RS00330 (ST4147_00330) | - | 56401..56637 (+) | 237 | WP_347229959.1 | hypothetical protein | - |
| ST4147_RS00335 (ST4147_00335) | - | 56654..56971 (+) | 318 | WP_347229950.1 | hypothetical protein | - |
| ST4147_RS00340 (ST4147_00340) | - | 56973..57245 (+) | 273 | WP_232972846.1 | MerR family transcriptional regulator | - |
| ST4147_RS00345 (ST4147_00345) | - | 57262..58119 (+) | 858 | WP_347229951.1 | primase alpha helix C-terminal domain-containing protein | - |
| ST4147_RS00350 (ST4147_00350) | - | 58455..59528 (+) | 1074 | WP_232981333.1 | virulence-associated E family protein | - |
| ST4147_RS00355 (ST4147_00355) | - | 59856..60038 (+) | 183 | WP_014727424.1 | hypothetical protein | - |
| ST4147_RS00360 (ST4147_00360) | - | 60838..61308 (+) | 471 | WP_347229952.1 | hypothetical protein | - |
| ST4147_RS00365 (ST4147_00365) | - | 61372..61908 (+) | 537 | WP_347229953.1 | hypothetical protein | - |
| ST4147_RS00370 (ST4147_00370) | - | 62430..62639 (+) | 210 | WP_347229954.1 | helix-turn-helix transcriptional regulator | - |
| ST4147_RS00375 (ST4147_00375) | prx | 62963..63148 (+) | 186 | WP_347229955.1 | Paratox | Regulator |
Sequence
Protein
Download Length: 61 a.a. Molecular weight: 7147.21 Da Isoelectric Point: 4.2558
>NTDB_id=511290 ST4147_RS00375 WP_347229955.1 62963..63148(+) (prx) [Streptococcus thermophilus strain 4147]
MLYYDELKEAIDRGFIKGDTVQIVKKNGIVFDYVLPNEPVKPYEVVTTERVADVLEELKEW
MLYYDELKEAIDRGFIKGDTVQIVKKNGIVFDYVLPNEPVKPYEVVTTERVADVLEELKEW
Nucleotide
Download Length: 186 bp
>NTDB_id=511290 ST4147_RS00375 WP_347229955.1 62963..63148(+) (prx) [Streptococcus thermophilus strain 4147]
ATGTTATATTATGATGAACTAAAAGAGGCAATCGATAGAGGTTTTATAAAGGGTGATACTGTTCAAATTGTGAAAAAGAA
TGGGATAGTATTTGATTATGTTCTCCCTAACGAACCAGTAAAGCCCTATGAGGTAGTTACTACTGAACGAGTAGCAGACG
TTTTGGAAGAGCTAAAAGAATGGTAA
ATGTTATATTATGATGAACTAAAAGAGGCAATCGATAGAGGTTTTATAAAGGGTGATACTGTTCAAATTGTGAAAAAGAA
TGGGATAGTATTTGATTATGTTCTCCCTAACGAACCAGTAAAGCCCTATGAGGTAGTTACTACTGAACGAGTAGCAGACG
TTTTGGAAGAGCTAAAAGAATGGTAA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS8232 |
64.407 |
96.721 |
0.623 |
| prx | Streptococcus pyogenes MGAS315 |
64.407 |
96.721 |
0.623 |
| prx | Streptococcus pyogenes MGAS315 |
65.517 |
95.082 |
0.623 |
| prx | Streptococcus pyogenes MGAS315 |
62.069 |
95.082 |
0.59 |
| prx | Streptococcus pyogenes MGAS315 |
69.048 |
68.852 |
0.475 |
| prx | Streptococcus pyogenes MGAS315 |
70.732 |
67.213 |
0.475 |
| prx | Streptococcus pyogenes MGAS315 |
65.854 |
67.213 |
0.443 |