Detailed information
Overview
| Name | prx | Type | Regulator |
| Locus tag | STT128_RS00395 | Genome accession | NZ_CP065500 |
| Coordinates | 64170..64358 (+) | Length | 62 a.a. |
| NCBI ID | WP_111679075.1 | Uniprot ID | - |
| Organism | Streptococcus thermophilus strain ST128 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 53468..65428 | 64170..64358 | within | 0 |
Gene organization within MGE regions
Location: 53468..65428
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| STT128_RS00305 (STT128_00305) | - | 53468..54634 (-) | 1167 | WP_347230087.1 | site-specific integrase | - |
| STT128_RS00310 (STT128_00310) | - | 54711..55295 (-) | 585 | WP_347230088.1 | helix-turn-helix domain-containing protein | - |
| STT128_RS00315 (STT128_00315) | - | 55457..55654 (+) | 198 | WP_014727431.1 | helix-turn-helix transcriptional regulator | - |
| STT128_RS00320 (STT128_00320) | - | 55872..56177 (+) | 306 | WP_347230089.1 | hypothetical protein | - |
| STT128_RS00325 (STT128_00325) | - | 56181..56387 (+) | 207 | WP_022096594.1 | hypothetical protein | - |
| STT128_RS00330 (STT128_00330) | - | 56401..56637 (+) | 237 | WP_023909301.1 | hypothetical protein | - |
| STT128_RS00335 (STT128_00335) | - | 56624..56965 (+) | 342 | WP_347230090.1 | hypothetical protein | - |
| STT128_RS00340 (STT128_00340) | - | 56967..57239 (+) | 273 | WP_023909303.1 | MerR family transcriptional regulator | - |
| STT128_RS00345 (STT128_00345) | - | 57255..58115 (+) | 861 | WP_347230091.1 | primase alpha helix C-terminal domain-containing protein | - |
| STT128_RS00350 (STT128_00350) | - | 58117..59613 (+) | 1497 | WP_347230178.1 | phage/plasmid primase, P4 family | - |
| STT128_RS00355 (STT128_00355) | - | 59915..60100 (+) | 186 | WP_011681033.1 | hypothetical protein | - |
| STT128_RS00360 (STT128_00360) | - | 60117..60392 (+) | 276 | WP_014608195.1 | hypothetical protein | - |
| STT128_RS00365 (STT128_00365) | - | 60611..61060 (+) | 450 | WP_011681031.1 | hypothetical protein | - |
| STT128_RS00370 (STT128_00370) | - | 61443..62030 (+) | 588 | WP_011681030.1 | hypothetical protein | - |
| STT128_RS00375 (STT128_00375) | - | 62094..62624 (+) | 531 | WP_011681029.1 | hypothetical protein | - |
| STT128_RS00380 (STT128_00380) | - | 62742..62948 (+) | 207 | WP_162484320.1 | hypothetical protein | - |
| STT128_RS00385 (STT128_00385) | - | 63190..63399 (+) | 210 | Protein_55 | transposase | - |
| STT128_RS00390 | - | 63478..63651 (+) | 174 | WP_347230092.1 | hypothetical protein | - |
| STT128_RS00395 (STT128_00395) | prx | 64170..64358 (+) | 189 | WP_111679075.1 | hypothetical protein | Regulator |
| STT128_RS00400 (STT128_00400) | - | 64739..65428 (+) | 690 | WP_197709066.1 | DUF3800 domain-containing protein | - |
Sequence
Protein
Download Length: 62 a.a. Molecular weight: 7133.08 Da Isoelectric Point: 4.5837
>NTDB_id=511169 STT128_RS00395 WP_111679075.1 64170..64358(+) (prx) [Streptococcus thermophilus strain ST128]
MLTYDEFKEAMDNGFIKGDTVQIVRKNGKIHDYVLDGERVEPHEILRLEKVSDIIKELGGDN
MLTYDEFKEAMDNGFIKGDTVQIVRKNGKIHDYVLDGERVEPHEILRLEKVSDIIKELGGDN
Nucleotide
Download Length: 189 bp
>NTDB_id=511169 STT128_RS00395 WP_111679075.1 64170..64358(+) (prx) [Streptococcus thermophilus strain ST128]
ATGCTAACCTATGATGAATTTAAAGAGGCAATGGACAATGGTTTTATTAAAGGTGATACTGTCCAGATTGTCCGAAAGAA
TGGTAAGATCCATGACTACGTTTTAGACGGTGAACGAGTTGAGCCACACGAAATATTGAGATTAGAAAAAGTATCGGATA
TAATAAAAGAACTAGGCGGAGACAACTAA
ATGCTAACCTATGATGAATTTAAAGAGGCAATGGACAATGGTTTTATTAAAGGTGATACTGTCCAGATTGTCCGAAAGAA
TGGTAAGATCCATGACTACGTTTTAGACGGTGAACGAGTTGAGCCACACGAAATATTGAGATTAGAAAAAGTATCGGATA
TAATAAAAGAACTAGGCGGAGACAACTAA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS315 |
60.345 |
93.548 |
0.565 |
| prx | Streptococcus pyogenes MGAS8232 |
59.322 |
95.161 |
0.565 |
| prx | Streptococcus pyogenes MGAS315 |
57.627 |
95.161 |
0.548 |
| prx | Streptococcus pyogenes MGAS315 |
56.897 |
93.548 |
0.532 |
| prx | Streptococcus pyogenes MGAS315 |
74.419 |
69.355 |
0.516 |
| prx | Streptococcus pyogenes MGAS315 |
65.957 |
75.806 |
0.5 |
| prx | Streptococcus pyogenes MGAS315 |
65.957 |
75.806 |
0.5 |