Detailed information
Overview
| Name | comA | Type | Regulator |
| Locus tag | STCNRZ1575_RS01535 | Genome accession | NZ_CP065490 |
| Coordinates | 273919..274128 (+) | Length | 69 a.a. |
| NCBI ID | WP_002946147.1 | Uniprot ID | - |
| Organism | Streptococcus thermophilus strain CNRZ1575 | ||
| Function | processing and transport of ComC (predicted from homology) Competence regulation |
||
Genomic Context
Location: 268919..279128
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| STCNRZ1575_RS01500 (STCNRZ1575_01515) | - | 269355..269864 (+) | 510 | WP_011680717.1 | tRNA (cytidine(34)-2'-O)-methyltransferase | - |
| STCNRZ1575_RS01505 (STCNRZ1575_01520) | - | 270176..270733 (+) | 558 | WP_002949523.1 | ECF transporter S component | - |
| STCNRZ1575_RS01510 (STCNRZ1575_01525) | - | 270736..271386 (+) | 651 | WP_095559229.1 | phosphatase PAP2 family protein | - |
| STCNRZ1575_RS01515 (STCNRZ1575_01530) | comR | 271581..272480 (+) | 900 | WP_179974221.1 | helix-turn-helix domain-containing protein | Regulator |
| STCNRZ1575_RS01520 | - | 272718..273014 (+) | 297 | Protein_233 | cysteine peptidase family C39 domain-containing protein | - |
| STCNRZ1575_RS01525 | comA | 273177..273413 (+) | 237 | WP_260214320.1 | ABC transporter transmembrane domain-containing protein | Regulator |
| STCNRZ1575_RS01530 | - | 273403..273897 (+) | 495 | Protein_235 | ABC transporter transmembrane domain-containing protein | - |
| STCNRZ1575_RS01535 | comA | 273919..274128 (+) | 210 | WP_002946147.1 | hypothetical protein | Regulator |
| STCNRZ1575_RS01540 (STCNRZ1575_01555) | - | 274183..274751 (+) | 569 | Protein_237 | ATP-binding cassette domain-containing protein | - |
| STCNRZ1575_RS01545 (STCNRZ1575_01560) | - | 274859..275176 (+) | 318 | WP_011225454.1 | DUF805 domain-containing protein | - |
| STCNRZ1575_RS01550 | - | 275139..275423 (-) | 285 | WP_014727318.1 | hypothetical protein | - |
| STCNRZ1575_RS01555 | - | 275663..276559 (-) | 897 | WP_260214319.1 | urease cluster protein | - |
| STCNRZ1575_RS01560 (STCNRZ1575_01570) | - | 276964..277479 (+) | 516 | WP_002949547.1 | AmiS/UreI family transporter | - |
| STCNRZ1575_RS01565 (STCNRZ1575_01575) | - | 277504..277806 (+) | 303 | WP_002886558.1 | urease subunit gamma | - |
| STCNRZ1575_RS01570 (STCNRZ1575_01580) | - | 277818..278129 (+) | 312 | WP_002886559.1 | urease subunit beta | - |
Sequence
Protein
Download Length: 69 a.a. Molecular weight: 8157.54 Da Isoelectric Point: 9.7339
>NTDB_id=510764 STCNRZ1575_RS01535 WP_002946147.1 273919..274128(+) (comA) [Streptococcus thermophilus strain CNRZ1575]
MITYSMLLNYFTTPLINIIYLQSKIQQAKVANNCLQEVYVVNKEEKGQLKDLSFKQLDLKGVSHRFRYQ
MITYSMLLNYFTTPLINIIYLQSKIQQAKVANNCLQEVYVVNKEEKGQLKDLSFKQLDLKGVSHRFRYQ
Nucleotide
Download Length: 210 bp
>NTDB_id=510764 STCNRZ1575_RS01535 WP_002946147.1 273919..274128(+) (comA) [Streptococcus thermophilus strain CNRZ1575]
TTGATTACCTATAGTATGTTGCTTAATTATTTTACGACTCCTTTAATTAATATTATCTATCTTCAATCTAAGATTCAGCA
AGCCAAGGTAGCCAATAATTGTCTTCAAGAAGTTTATGTTGTGAATAAGGAAGAAAAAGGTCAACTCAAAGATTTATCCT
TTAAACAATTAGACTTAAAAGGTGTTAGTCATCGTTTCAGATACCAATAA
TTGATTACCTATAGTATGTTGCTTAATTATTTTACGACTCCTTTAATTAATATTATCTATCTTCAATCTAAGATTCAGCA
AGCCAAGGTAGCCAATAATTGTCTTCAAGAAGTTTATGTTGTGAATAAGGAAGAAAAAGGTCAACTCAAAGATTTATCCT
TTAAACAATTAGACTTAAAAGGTGTTAGTCATCGTTTCAGATACCAATAA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comA | Streptococcus gordonii str. Challis substr. CH1 |
54.167 |
100 |
0.565 |
| comA | Streptococcus mitis NCTC 12261 |
52.778 |
100 |
0.551 |
| comA | Streptococcus pneumoniae Rx1 |
51.389 |
100 |
0.536 |
| comA | Streptococcus pneumoniae D39 |
51.389 |
100 |
0.536 |
| comA | Streptococcus pneumoniae R6 |
51.389 |
100 |
0.536 |
| comA | Streptococcus pneumoniae TIGR4 |
51.389 |
100 |
0.536 |
| comA | Streptococcus mitis SK321 |
50 |
100 |
0.522 |
| comA/nlmT | Streptococcus mutans UA159 |
44.286 |
100 |
0.449 |