Detailed information
Bioinformatically predicted
Overview
| Name | prx | Type | Regulator |
| Locus tag | I2438_RS07940 | Genome accession | NZ_CP065190 |
| Coordinates | 1637068..1637250 (-) | Length | 60 a.a. |
| NCBI ID | WP_206156615.1 | Uniprot ID | - |
| Organism | Streptococcus equi subsp. zooepidemicus strain SEZ36 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1635960..1682533 | 1637068..1637250 | within | 0 |
Gene organization within MGE regions
Location: 1635960..1682533
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| I2438_RS07935 (HCFMJIKG_01577) | - | 1635960..1636928 (-) | 969 | WP_012516123.1 | helix-hairpin-helix domain-containing protein | - |
| I2438_RS07940 (HCFMJIKG_01578) | prx | 1637068..1637250 (-) | 183 | WP_206156615.1 | Paratox | Regulator |
| I2438_RS07950 (HCFMJIKG_01580) | - | 1637599..1638174 (-) | 576 | WP_012679345.1 | phospholipase A2 SlaA | - |
| I2438_RS07955 (HCFMJIKG_01581) | - | 1638547..1639383 (-) | 837 | WP_012679343.1 | hypothetical protein | - |
| I2438_RS07960 (HCFMJIKG_01582) | - | 1639387..1639929 (-) | 543 | WP_012679342.1 | Panacea domain-containing protein | - |
| I2438_RS07965 (HCFMJIKG_01583) | - | 1640064..1641260 (-) | 1197 | WP_012679341.1 | glucosaminidase domain-containing protein | - |
| I2438_RS07970 (HCFMJIKG_01585) | - | 1641372..1641551 (-) | 180 | WP_012679339.1 | holin | - |
| I2438_RS07975 (HCFMJIKG_01586) | - | 1641554..1641844 (-) | 291 | WP_012679338.1 | hypothetical protein | - |
| I2438_RS07980 (HCFMJIKG_01587) | - | 1641857..1642471 (-) | 615 | WP_012679337.1 | DUF1366 domain-containing protein | - |
| I2438_RS07985 (HCFMJIKG_01588) | - | 1642474..1642905 (-) | 432 | WP_012679336.1 | DUF1617 family protein | - |
| I2438_RS07990 (HCFMJIKG_01589) | - | 1642914..1644797 (-) | 1884 | WP_231147191.1 | gp58-like family protein | - |
| I2438_RS07995 (HCFMJIKG_01590) | - | 1644930..1645688 (-) | 759 | WP_165628215.1 | BRO family protein | - |
| I2438_RS08000 (HCFMJIKG_01591) | - | 1645751..1646023 (-) | 273 | WP_043053024.1 | hypothetical protein | - |
| I2438_RS08005 (HCFMJIKG_01592) | - | 1646138..1646317 (-) | 180 | WP_043053058.1 | CopG family transcriptional regulator | - |
| I2438_RS08010 (HCFMJIKG_01593) | - | 1646456..1647070 (-) | 615 | WP_337972307.1 | hypothetical protein | - |
| I2438_RS08015 | - | 1647606..1647776 (-) | 171 | Protein_1558 | hyaluronoglucosaminidase | - |
| I2438_RS08020 (HCFMJIKG_01595) | - | 1647773..1649881 (-) | 2109 | WP_231146518.1 | phage tail spike protein | - |
| I2438_RS08025 (HCFMJIKG_01596) | - | 1649878..1650648 (-) | 771 | WP_231146517.1 | distal tail protein Dit | - |
| I2438_RS08030 (HCFMJIKG_01597) | - | 1650648..1653647 (-) | 3000 | WP_231146516.1 | phage tail tape measure protein | - |
| I2438_RS08035 (HCFMJIKG_01598) | - | 1653657..1653848 (-) | 192 | WP_231146515.1 | hypothetical protein | - |
| I2438_RS08040 (HCFMJIKG_01599) | - | 1653986..1654354 (-) | 369 | WP_231146514.1 | tail assembly chaperone | - |
| I2438_RS08045 (HCFMJIKG_01600) | - | 1654367..1654930 (-) | 564 | WP_231146513.1 | phage major tail protein, TP901-1 family | - |
| I2438_RS08050 (HCFMJIKG_01601) | - | 1654931..1655317 (-) | 387 | WP_231146512.1 | hypothetical protein | - |
| I2438_RS08055 (HCFMJIKG_01602) | - | 1655314..1655670 (-) | 357 | WP_231146511.1 | HK97-gp10 family putative phage morphogenesis protein | - |
| I2438_RS08060 (HCFMJIKG_01603) | - | 1655670..1655966 (-) | 297 | WP_231146510.1 | hypothetical protein | - |
| I2438_RS08065 (HCFMJIKG_01604) | - | 1655963..1656316 (-) | 354 | WP_231146509.1 | phage head-tail connector protein | - |
| I2438_RS08070 (HCFMJIKG_01605) | - | 1656326..1656595 (-) | 270 | WP_231146508.1 | HeH/LEM domain-containing protein | - |
| I2438_RS08075 (HCFMJIKG_01606) | - | 1656607..1657656 (-) | 1050 | WP_231146507.1 | major capsid protein | - |
| I2438_RS08080 (HCFMJIKG_01607) | - | 1657659..1658039 (-) | 381 | WP_231146506.1 | head decoration protein | - |
| I2438_RS08085 (HCFMJIKG_01608) | - | 1658049..1658669 (-) | 621 | WP_231146505.1 | DUF4355 domain-containing protein | - |
| I2438_RS08090 (HCFMJIKG_01609) | - | 1658884..1659150 (-) | 267 | WP_231146504.1 | hypothetical protein | - |
| I2438_RS08095 (HCFMJIKG_01610) | - | 1659166..1660086 (-) | 921 | WP_231146503.1 | minor capsid protein | - |
| I2438_RS08100 (HCFMJIKG_01611) | - | 1660061..1661557 (-) | 1497 | WP_231146502.1 | phage portal protein | - |
| I2438_RS08105 (HCFMJIKG_01612) | - | 1661569..1662855 (-) | 1287 | WP_231146501.1 | PBSX family phage terminase large subunit | - |
| I2438_RS08110 (HCFMJIKG_01613) | - | 1662839..1663294 (-) | 456 | WP_050316437.1 | hypothetical protein | - |
| I2438_RS08115 (HCFMJIKG_01614) | - | 1663407..1664570 (-) | 1164 | WP_050317011.1 | DNA modification methylase | - |
| I2438_RS08120 (HCFMJIKG_01615) | - | 1664780..1665214 (-) | 435 | WP_050317012.1 | ArpU family phage packaging/lysis transcriptional regulator | - |
| I2438_RS08125 (HCFMJIKG_01616) | - | 1665290..1665505 (-) | 216 | WP_231146500.1 | crAss001_48 related protein | - |
| I2438_RS08130 (HCFMJIKG_01617) | - | 1665505..1665813 (-) | 309 | WP_206156609.1 | hypothetical protein | - |
| I2438_RS08135 (HCFMJIKG_01618) | - | 1665990..1666346 (-) | 357 | Protein_1582 | DUF1642 domain-containing protein | - |
| I2438_RS08140 (HCFMJIKG_01619) | - | 1666395..1667159 (-) | 765 | WP_206156608.1 | DNA-methyltransferase | - |
| I2438_RS08145 (HCFMJIKG_01620) | - | 1667149..1667376 (-) | 228 | WP_206156607.1 | hypothetical protein | - |
| I2438_RS08150 (HCFMJIKG_01621) | - | 1667369..1667569 (-) | 201 | WP_206156606.1 | hypothetical protein | - |
| I2438_RS08155 (HCFMJIKG_01622) | - | 1667574..1667786 (-) | 213 | WP_206156605.1 | hypothetical protein | - |
| I2438_RS08160 (HCFMJIKG_01623) | - | 1667827..1668219 (-) | 393 | WP_206156604.1 | YopX family protein | - |
| I2438_RS08165 (HCFMJIKG_01624) | - | 1668203..1668454 (-) | 252 | WP_012678847.1 | hypothetical protein | - |
| I2438_RS08170 (HCFMJIKG_01625) | - | 1668451..1668735 (-) | 285 | WP_050317102.1 | DUF3310 domain-containing protein | - |
| I2438_RS08175 (HCFMJIKG_01626) | - | 1668713..1668916 (-) | 204 | WP_206156603.1 | hypothetical protein | - |
| I2438_RS08180 (HCFMJIKG_01627) | - | 1668919..1669143 (-) | 225 | WP_050315882.1 | hypothetical protein | - |
| I2438_RS08185 (HCFMJIKG_01628) | - | 1669140..1669535 (-) | 396 | WP_050315883.1 | RusA family crossover junction endodeoxyribonuclease | - |
| I2438_RS08190 (HCFMJIKG_01629) | - | 1669528..1669746 (-) | 219 | WP_050315884.1 | crAss001_48 related protein | - |
| I2438_RS08195 (HCFMJIKG_01630) | - | 1670017..1672302 (-) | 2286 | WP_206156602.1 | AAA family ATPase | - |
| I2438_RS08200 (HCFMJIKG_01631) | - | 1672315..1673898 (-) | 1584 | WP_050316123.1 | DEAD/DEAH box helicase | - |
| I2438_RS08205 (HCFMJIKG_01632) | - | 1673898..1674500 (-) | 603 | WP_050316124.1 | hypothetical protein | - |
| I2438_RS08210 (HCFMJIKG_01633) | - | 1674521..1675255 (-) | 735 | WP_050316125.1 | hypothetical protein | - |
| I2438_RS08215 (HCFMJIKG_01634) | - | 1675257..1675679 (-) | 423 | WP_050315889.1 | hypothetical protein | - |
| I2438_RS08220 (HCFMJIKG_01635) | - | 1675719..1676798 (-) | 1080 | WP_050315890.1 | ATP-binding protein | - |
| I2438_RS08225 (HCFMJIKG_01636) | - | 1676814..1678133 (-) | 1320 | WP_165627055.1 | AAA family ATPase | - |
| I2438_RS08230 (HCFMJIKG_01637) | - | 1678136..1678312 (-) | 177 | WP_206156601.1 | hypothetical protein | - |
| I2438_RS08235 (HCFMJIKG_01638) | - | 1678293..1678433 (-) | 141 | WP_206156600.1 | hypothetical protein | - |
| I2438_RS08240 (HCFMJIKG_01639) | - | 1678464..1678715 (-) | 252 | WP_161458456.1 | helix-turn-helix transcriptional regulator | - |
| I2438_RS08245 (HCFMJIKG_01640) | - | 1678787..1678993 (-) | 207 | WP_206156599.1 | helix-turn-helix domain-containing protein | - |
| I2438_RS08250 (HCFMJIKG_01641) | - | 1679121..1679321 (-) | 201 | WP_038433319.1 | helix-turn-helix domain-containing protein | - |
| I2438_RS08255 (HCFMJIKG_01642) | - | 1679480..1680304 (+) | 825 | WP_206156598.1 | XRE family transcriptional regulator | - |
| I2438_RS08260 (HCFMJIKG_01643) | - | 1680519..1681193 (+) | 675 | WP_154803906.1 | NYN domain-containing protein | - |
| I2438_RS08265 (HCFMJIKG_01644) | - | 1681367..1682533 (+) | 1167 | WP_064056124.1 | tyrosine-type recombinase/integrase | - |
Sequence
Protein
Download Length: 60 a.a. Molecular weight: 7041.92 Da Isoelectric Point: 4.0606
>NTDB_id=507779 I2438_RS07940 WP_206156615.1 1637068..1637250(-) (prx) [Streptococcus equi subsp. zooepidemicus strain SEZ36]
MLTYDEFKQAVDNGYITGDTVTIVRKNGQILDYVLPHEEVQPWEVVTEEKVEEVMRELDK
MLTYDEFKQAVDNGYITGDTVTIVRKNGQILDYVLPHEEVQPWEVVTEEKVEEVMRELDK
Nucleotide
Download Length: 183 bp
>NTDB_id=507779 I2438_RS07940 WP_206156615.1 1637068..1637250(-) (prx) [Streptococcus equi subsp. zooepidemicus strain SEZ36]
ATGCTAACATACGACGAATTTAAGCAGGCAGTTGATAACGGTTATATCACAGGCGACACAGTCACGATCGTGCGTAAAAA
CGGACAGATTTTGGATTATGTGTTGCCGCATGAGGAAGTGCAGCCTTGGGAAGTGGTGACCGAGGAAAAAGTGGAAGAGG
TGATGAGAGAATTAGACAAATAA
ATGCTAACATACGACGAATTTAAGCAGGCAGTTGATAACGGTTATATCACAGGCGACACAGTCACGATCGTGCGTAAAAA
CGGACAGATTTTGGATTATGTGTTGCCGCATGAGGAAGTGCAGCCTTGGGAAGTGGTGACCGAGGAAAAAGTGGAAGAGG
TGATGAGAGAATTAGACAAATAA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS315 |
80 |
100 |
0.8 |
| prx | Streptococcus pyogenes MGAS315 |
80 |
100 |
0.8 |
| prx | Streptococcus pyogenes MGAS315 |
76.667 |
100 |
0.767 |
| prx | Streptococcus pyogenes MGAS8232 |
76.667 |
100 |
0.767 |
| prx | Streptococcus pyogenes MGAS315 |
71.667 |
100 |
0.717 |
| prx | Streptococcus pyogenes MGAS315 |
82.927 |
68.333 |
0.567 |
| prx | Streptococcus pyogenes MGAS315 |
73.171 |
68.333 |
0.5 |