Detailed information
Bioinformatically predicted
Overview
| Name | prx | Type | Regulator |
| Locus tag | I2438_RS02830 | Genome accession | NZ_CP065190 |
| Coordinates | 531081..531260 (+) | Length | 59 a.a. |
| NCBI ID | WP_050319824.1 | Uniprot ID | - |
| Organism | Streptococcus equi subsp. zooepidemicus strain SEZ36 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 490696..532382 | 531081..531260 | within | 0 |
Gene organization within MGE regions
Location: 490696..532382
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| I2438_RS02575 (HCFMJIKG_00505) | - | 490696..491775 (-) | 1080 | WP_015986699.1 | tyrosine-type recombinase/integrase | - |
| I2438_RS02580 (HCFMJIKG_00506) | - | 491894..492445 (-) | 552 | WP_015986700.1 | hypothetical protein | - |
| I2438_RS02585 (HCFMJIKG_00507) | - | 492456..492839 (-) | 384 | WP_015986701.1 | ImmA/IrrE family metallo-endopeptidase | - |
| I2438_RS02590 (HCFMJIKG_00508) | - | 492853..493206 (-) | 354 | WP_000464420.1 | helix-turn-helix domain-containing protein | - |
| I2438_RS02595 (HCFMJIKG_00509) | - | 493968..494159 (+) | 192 | WP_001283052.1 | hypothetical protein | - |
| I2438_RS02600 (HCFMJIKG_00510) | - | 494210..494410 (+) | 201 | WP_231146360.1 | hypothetical protein | - |
| I2438_RS02605 (HCFMJIKG_00511) | - | 494476..494751 (+) | 276 | WP_015986704.1 | hypothetical protein | - |
| I2438_RS02610 (HCFMJIKG_00512) | - | 494748..494918 (+) | 171 | WP_015986705.1 | hypothetical protein | - |
| I2438_RS02615 (HCFMJIKG_00513) | - | 494911..495117 (+) | 207 | WP_050317062.1 | hypothetical protein | - |
| I2438_RS02620 (HCFMJIKG_00514) | - | 495114..495497 (+) | 384 | WP_337972318.1 | hypothetical protein | - |
| I2438_RS02625 (HCFMJIKG_00515) | - | 495494..495646 (+) | 153 | WP_002983406.1 | hypothetical protein | - |
| I2438_RS02630 (HCFMJIKG_00516) | - | 495643..495846 (+) | 204 | WP_002983407.1 | hypothetical protein | - |
| I2438_RS02635 (HCFMJIKG_00517) | - | 495934..496233 (+) | 300 | WP_002988708.1 | hypothetical protein | - |
| I2438_RS02640 (HCFMJIKG_00518) | - | 496233..497390 (+) | 1158 | WP_015986706.1 | DUF2800 domain-containing protein | - |
| I2438_RS02645 (HCFMJIKG_00519) | - | 497404..497967 (+) | 564 | WP_002983410.1 | DUF2815 family protein | - |
| I2438_RS02650 (HCFMJIKG_00520) | - | 498010..499932 (+) | 1923 | WP_015986708.1 | DNA polymerase | - |
| I2438_RS02655 (HCFMJIKG_00521) | - | 499937..502321 (+) | 2385 | WP_050317067.1 | phage/plasmid primase, P4 family | - |
| I2438_RS02660 (HCFMJIKG_00522) | - | 502688..502963 (+) | 276 | WP_002988730.1 | VRR-NUC domain-containing protein | - |
| I2438_RS02665 (HCFMJIKG_00523) | - | 502960..504282 (+) | 1323 | WP_015986711.1 | SNF2-related protein | - |
| I2438_RS02670 (HCFMJIKG_00524) | - | 504283..504450 (+) | 168 | WP_015986712.1 | hypothetical protein | - |
| I2438_RS02675 (HCFMJIKG_00525) | - | 504447..504620 (+) | 174 | WP_015986713.1 | hypothetical protein | - |
| I2438_RS02680 (HCFMJIKG_00526) | - | 504620..504889 (+) | 270 | WP_050317163.1 | hypothetical protein | - |
| I2438_RS02685 (HCFMJIKG_00528) | - | 505092..505508 (+) | 417 | WP_002988747.1 | DUF722 domain-containing protein | - |
| I2438_RS02690 (HCFMJIKG_00529) | - | 505598..506050 (+) | 453 | WP_011106637.1 | terminase small subunit | - |
| I2438_RS02695 (HCFMJIKG_00530) | - | 506040..507317 (+) | 1278 | WP_050318640.1 | PBSX family phage terminase large subunit | - |
| I2438_RS02700 (HCFMJIKG_00531) | - | 507333..508865 (+) | 1533 | WP_023611655.1 | phage portal protein | - |
| I2438_RS02705 (HCFMJIKG_00532) | - | 508825..510270 (+) | 1446 | WP_050317145.1 | minor capsid protein | - |
| I2438_RS02710 | - | 510301..510489 (+) | 189 | WP_002983423.1 | hypothetical protein | - |
| I2438_RS02715 (HCFMJIKG_00534) | - | 510492..510758 (+) | 267 | WP_050317087.1 | hypothetical protein | - |
| I2438_RS02720 (HCFMJIKG_00535) | - | 510914..511483 (+) | 570 | WP_214495220.1 | DUF4355 domain-containing protein | - |
| I2438_RS02725 (HCFMJIKG_00536) | - | 511496..512383 (+) | 888 | WP_002983429.1 | hypothetical protein | - |
| I2438_RS02730 (HCFMJIKG_00537) | - | 512395..512751 (+) | 357 | WP_011054873.1 | phage head-tail connector protein | - |
| I2438_RS02735 (HCFMJIKG_00538) | - | 512762..513040 (+) | 279 | WP_011054872.1 | hypothetical protein | - |
| I2438_RS02740 (HCFMJIKG_00539) | - | 513037..513381 (+) | 345 | WP_011106640.1 | HK97-gp10 family putative phage morphogenesis protein | - |
| I2438_RS02745 (HCFMJIKG_00540) | - | 513385..513744 (+) | 360 | WP_011054870.1 | hypothetical protein | - |
| I2438_RS02750 (HCFMJIKG_00541) | - | 513756..514355 (+) | 600 | WP_011054869.1 | phage major tail protein, TP901-1 family | - |
| I2438_RS02755 (HCFMJIKG_00542) | - | 514409..514864 (+) | 456 | WP_011888931.1 | tail assembly chaperone | - |
| I2438_RS02760 (HCFMJIKG_00543) | - | 514939..515172 (+) | 234 | WP_011888930.1 | hypothetical protein | - |
| I2438_RS02765 (HCFMJIKG_00544) | - | 515187..519569 (+) | 4383 | WP_050316009.1 | tape measure protein | - |
| I2438_RS02770 (HCFMJIKG_00545) | - | 519581..520423 (+) | 843 | WP_015986718.1 | phage tail family protein | - |
| I2438_RS02775 (HCFMJIKG_00546) | - | 520433..522415 (+) | 1983 | WP_015986719.1 | phage tail protein | - |
| I2438_RS02780 (HCFMJIKG_00547) | - | 522415..523515 (+) | 1101 | WP_015986720.1 | hyaluronidase | - |
| I2438_RS02785 (HCFMJIKG_00548) | - | 523534..525438 (+) | 1905 | WP_214494463.1 | gp58-like family protein | - |
| I2438_RS02790 (HCFMJIKG_00549) | - | 525447..525878 (+) | 432 | WP_015986722.1 | DUF1617 family protein | - |
| I2438_RS02795 (HCFMJIKG_00550) | - | 525881..526492 (+) | 612 | WP_050317156.1 | hypothetical protein | - |
| I2438_RS02800 (HCFMJIKG_00551) | - | 526502..526777 (+) | 276 | WP_002987582.1 | DUF7365 family protein | - |
| I2438_RS02805 (HCFMJIKG_00552) | - | 526774..527001 (+) | 228 | WP_003058873.1 | phage holin | - |
| I2438_RS02810 (HCFMJIKG_00554) | - | 527117..528319 (+) | 1203 | WP_015986725.1 | glucosaminidase domain-containing protein | - |
| I2438_RS02815 (HCFMJIKG_00555) | - | 528472..528993 (+) | 522 | WP_015986726.1 | Panacea domain-containing protein | - |
| I2438_RS02820 (HCFMJIKG_00556) | - | 528984..529793 (+) | 810 | WP_015986727.1 | hypothetical protein | - |
| I2438_RS02825 (HCFMJIKG_00557) | - | 529856..530848 (-) | 993 | WP_015986728.1 | DNA/RNA non-specific endonuclease | - |
| I2438_RS02830 (HCFMJIKG_00558) | prx | 531081..531260 (+) | 180 | WP_050319824.1 | hypothetical protein | Regulator |
| I2438_RS02835 (HCFMJIKG_00559) | - | 531867..532382 (-) | 516 | WP_021320424.1 | hypothetical protein | - |
Sequence
Protein
Download Length: 59 a.a. Molecular weight: 6931.74 Da Isoelectric Point: 3.8957
>NTDB_id=507754 I2438_RS02830 WP_050319824.1 531081..531260(+) (prx) [Streptococcus equi subsp. zooepidemicus strain SEZ36]
MLTYDEFKQAIDDGYITGDTVAIVRKNGQIFDYVLPHEEVRSWEVSIEEIVEEVLRELE
MLTYDEFKQAIDDGYITGDTVAIVRKNGQIFDYVLPHEEVRSWEVSIEEIVEEVLRELE
Nucleotide
Download Length: 180 bp
>NTDB_id=507754 I2438_RS02830 WP_050319824.1 531081..531260(+) (prx) [Streptococcus equi subsp. zooepidemicus strain SEZ36]
ATGCTAACATACGACGAATTTAAACAGGCAATTGATGACGGATATATCACAGGAGACACAGTAGCGATCGTGCGCAAAAA
CGGACAGATTTTTGATTATGTATTGCCGCATGAGGAAGTGAGGTCGTGGGAGGTGTCAATAGAAGAAATAGTGGAAGAAG
TGCTGCGGGAATTGGAGTAA
ATGCTAACATACGACGAATTTAAACAGGCAATTGATGACGGATATATCACAGGAGACACAGTAGCGATCGTGCGCAAAAA
CGGACAGATTTTTGATTATGTATTGCCGCATGAGGAAGTGAGGTCGTGGGAGGTGTCAATAGAAGAAATAGTGGAAGAAG
TGCTGCGGGAATTGGAGTAA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS315 |
84.746 |
100 |
0.847 |
| prx | Streptococcus pyogenes MGAS315 |
79.661 |
100 |
0.797 |
| prx | Streptococcus pyogenes MGAS8232 |
79.31 |
98.305 |
0.78 |
| prx | Streptococcus pyogenes MGAS315 |
74.138 |
98.305 |
0.729 |
| prx | Streptococcus pyogenes MGAS315 |
90.476 |
71.186 |
0.644 |
| prx | Streptococcus pyogenes MGAS315 |
88.095 |
71.186 |
0.627 |
| prx | Streptococcus pyogenes MGAS315 |
82.927 |
69.492 |
0.576 |