Detailed information
Overview
| Name | prx | Type | Regulator |
| Locus tag | I2438_RS01000 | Genome accession | NZ_CP065190 |
| Coordinates | 160785..160976 (+) | Length | 63 a.a. |
| NCBI ID | WP_050316475.1 | Uniprot ID | - |
| Organism | Streptococcus equi subsp. zooepidemicus strain SEZ36 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 118146..163680 | 160785..160976 | within | 0 |
Gene organization within MGE regions
Location: 118146..163680
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| I2438_RS00710 (HCFMJIKG_00139) | - | 118146..118511 (+) | 366 | WP_012514777.1 | DUF1033 family protein | - |
| I2438_RS00715 | - | 118793..118984 (+) | 192 | Protein_107 | lactococcin 972 family bacteriocin | - |
| I2438_RS00720 (HCFMJIKG_00140) | - | 119049..121052 (+) | 2004 | WP_021320258.1 | DUF1430 domain-containing protein | - |
| I2438_RS00725 (HCFMJIKG_00141) | - | 121054..121722 (+) | 669 | WP_012514779.1 | ATP-binding cassette domain-containing protein | - |
| I2438_RS00730 (HCFMJIKG_00142) | comGA/cglA | 121878..122816 (+) | 939 | WP_021320259.1 | competence type IV pilus ATPase ComGA | Machinery gene |
| I2438_RS00735 (HCFMJIKG_00143) | comYB | 122749..123783 (+) | 1035 | WP_229297307.1 | competence type IV pilus assembly protein ComGB | Machinery gene |
| I2438_RS00740 (HCFMJIKG_00144) | - | 123864..125309 (-) | 1446 | WP_231146423.1 | recombinase family protein | - |
| I2438_RS00745 (HCFMJIKG_00145) | - | 125433..126164 (-) | 732 | WP_231146422.1 | XRE family transcriptional regulator | - |
| I2438_RS00750 (HCFMJIKG_00146) | - | 126326..126538 (+) | 213 | WP_214504394.1 | helix-turn-helix domain-containing protein | - |
| I2438_RS00755 (HCFMJIKG_00147) | - | 126778..126954 (+) | 177 | WP_231146421.1 | BOW99_gp33 family protein | - |
| I2438_RS00760 | - | 126973..127143 (+) | 171 | Protein_116 | excisionase | - |
| I2438_RS00765 (HCFMJIKG_00148) | - | 127146..127286 (+) | 141 | WP_173476844.1 | hypothetical protein | - |
| I2438_RS00770 (HCFMJIKG_00149) | - | 127286..127432 (+) | 147 | WP_154244050.1 | hypothetical protein | - |
| I2438_RS00775 (HCFMJIKG_00150) | - | 127435..127776 (+) | 342 | WP_012679297.1 | hypothetical protein | - |
| I2438_RS00780 (HCFMJIKG_00151) | - | 127776..128258 (+) | 483 | WP_012679298.1 | siphovirus Gp157 family protein | - |
| I2438_RS00785 (HCFMJIKG_00152) | - | 128255..128728 (+) | 474 | WP_012679299.1 | hypothetical protein | - |
| I2438_RS00790 (HCFMJIKG_00153) | - | 128688..129863 (+) | 1176 | WP_050316389.1 | DEAD/DEAH box helicase family protein | - |
| I2438_RS00795 (HCFMJIKG_00154) | - | 129873..130583 (+) | 711 | WP_012679301.1 | ERF family protein | - |
| I2438_RS00800 (HCFMJIKG_00155) | ssb | 130584..130976 (+) | 393 | WP_050316388.1 | single-stranded DNA-binding protein | Machinery gene |
| I2438_RS00805 (HCFMJIKG_00156) | - | 130990..131817 (+) | 828 | WP_050316387.1 | bifunctional DNA primase/polymerase | - |
| I2438_RS00810 (HCFMJIKG_00157) | - | 131801..133201 (+) | 1401 | WP_050316386.1 | virulence-associated E family protein | - |
| I2438_RS00815 (HCFMJIKG_00158) | - | 133547..133741 (+) | 195 | WP_050316385.1 | DUF7204 family protein | - |
| I2438_RS00820 (HCFMJIKG_00159) | - | 133734..133961 (+) | 228 | WP_050316384.1 | hypothetical protein | - |
| I2438_RS00825 (HCFMJIKG_00160) | - | 133951..134661 (+) | 711 | WP_231147179.1 | DNA-methyltransferase | - |
| I2438_RS00830 (HCFMJIKG_00161) | - | 134712..134942 (+) | 231 | WP_050316383.1 | DUF1642 domain-containing protein | - |
| I2438_RS00835 (HCFMJIKG_00162) | - | 134939..135226 (+) | 288 | WP_050316382.1 | hypothetical protein | - |
| I2438_RS00840 (HCFMJIKG_00163) | - | 135226..135441 (+) | 216 | WP_050316381.1 | crAss001_48 related protein | - |
| I2438_RS00845 (HCFMJIKG_00164) | - | 135515..135952 (+) | 438 | WP_050316380.1 | DUF1492 domain-containing protein | - |
| I2438_RS00850 (HCFMJIKG_00165) | - | 136198..136641 (+) | 444 | WP_230373400.1 | terminase small subunit | - |
| I2438_RS00855 (HCFMJIKG_00166) | - | 136631..137929 (+) | 1299 | WP_050315874.1 | PBSX family phage terminase large subunit | - |
| I2438_RS00860 (HCFMJIKG_00167) | - | 137939..139438 (+) | 1500 | WP_050316378.1 | phage portal protein | - |
| I2438_RS00865 (HCFMJIKG_00168) | - | 139438..141048 (+) | 1611 | WP_050315872.1 | phage minor capsid protein | - |
| I2438_RS00870 (HCFMJIKG_00169) | - | 141014..141235 (+) | 222 | WP_050315871.1 | CPCC family cysteine-rich protein | - |
| I2438_RS00875 (HCFMJIKG_00170) | - | 141287..141571 (+) | 285 | WP_050315870.1 | hypothetical protein | - |
| I2438_RS00880 (HCFMJIKG_00171) | - | 141657..141896 (+) | 240 | WP_050318689.1 | hypothetical protein | - |
| I2438_RS00885 (HCFMJIKG_00172) | - | 141881..142471 (+) | 591 | WP_050318688.1 | hypothetical protein | - |
| I2438_RS00890 (HCFMJIKG_00173) | - | 142485..143357 (+) | 873 | WP_050318686.1 | hypothetical protein | - |
| I2438_RS00895 (HCFMJIKG_00174) | - | 143371..143610 (+) | 240 | WP_050318684.1 | hypothetical protein | - |
| I2438_RS00900 (HCFMJIKG_00175) | - | 143613..143999 (+) | 387 | WP_050318682.1 | hypothetical protein | - |
| I2438_RS00905 (HCFMJIKG_00176) | - | 143993..144337 (+) | 345 | WP_050318680.1 | putative minor capsid protein | - |
| I2438_RS00910 (HCFMJIKG_00177) | - | 144334..144687 (+) | 354 | WP_050318679.1 | minor capsid protein | - |
| I2438_RS00915 (HCFMJIKG_00178) | - | 144690..145058 (+) | 369 | WP_050318677.1 | hypothetical protein | - |
| I2438_RS00920 (HCFMJIKG_00179) | - | 145062..145559 (+) | 498 | WP_050316279.1 | phage tail tube protein | - |
| I2438_RS00925 (HCFMJIKG_00180) | - | 145579..145986 (+) | 408 | WP_050315860.1 | hypothetical protein | - |
| I2438_RS00930 (HCFMJIKG_00181) | - | 145994..146611 (+) | 618 | WP_050316278.1 | Gp15 family bacteriophage protein | - |
| I2438_RS00935 (HCFMJIKG_00182) | - | 146612..149059 (+) | 2448 | WP_050316374.1 | phage tail tape measure protein | - |
| I2438_RS00940 (HCFMJIKG_00183) | - | 149063..149824 (+) | 762 | WP_050315857.1 | phage tail domain-containing protein | - |
| I2438_RS00945 (HCFMJIKG_00184) | - | 149835..151832 (+) | 1998 | WP_231146417.1 | phage tail protein | - |
| I2438_RS00950 (HCFMJIKG_00185) | - | 151832..152506 (+) | 675 | WP_231146416.1 | collagen-like protein | - |
| I2438_RS00955 (HCFMJIKG_00186) | - | 152508..153122 (+) | 615 | WP_231146415.1 | hypothetical protein | - |
| I2438_RS00960 (HCFMJIKG_00187) | - | 153133..155016 (+) | 1884 | WP_231146414.1 | gp58-like family protein | - |
| I2438_RS00965 (HCFMJIKG_00188) | - | 155025..155456 (+) | 432 | WP_050322829.1 | DUF1617 family protein | - |
| I2438_RS00970 (HCFMJIKG_00189) | - | 155460..156071 (+) | 612 | WP_050317086.1 | DUF1366 domain-containing protein | - |
| I2438_RS00975 (HCFMJIKG_00190) | - | 156082..156453 (+) | 372 | WP_012678881.1 | phage holin family protein | - |
| I2438_RS00980 (HCFMJIKG_00192) | - | 156569..157765 (+) | 1197 | WP_050317189.1 | glucosaminidase domain-containing protein | - |
| I2438_RS00985 (HCFMJIKG_00193) | - | 157904..158428 (+) | 525 | WP_037578457.1 | Panacea domain-containing protein | - |
| I2438_RS00990 (HCFMJIKG_00194) | - | 158416..159279 (+) | 864 | WP_050321679.1 | DUF334 domain-containing protein | - |
| I2438_RS00995 (HCFMJIKG_00195) | - | 159393..160544 (-) | 1152 | WP_037578452.1 | DNA/RNA non-specific endonuclease | - |
| I2438_RS01000 (HCFMJIKG_00196) | prx | 160785..160976 (+) | 192 | WP_050316475.1 | hypothetical protein | Regulator |
| I2438_RS01005 (HCFMJIKG_00197) | comYC | 160991..161254 (+) | 264 | WP_050316474.1 | competence type IV pilus major pilin ComGC | Machinery gene |
| I2438_RS01010 (HCFMJIKG_00198) | comGD | 161232..161657 (+) | 426 | WP_231146413.1 | competence type IV pilus minor pilin ComGD | - |
| I2438_RS01015 (HCFMJIKG_00199) | comGE | 161662..161904 (+) | 243 | WP_012677236.1 | competence type IV pilus minor pilin ComGE | - |
| I2438_RS01020 (HCFMJIKG_00200) | comYF | 161891..162325 (+) | 435 | WP_014622144.1 | competence type IV pilus minor pilin ComGF | Machinery gene |
| I2438_RS01025 (HCFMJIKG_00201) | comGG | 162303..162665 (+) | 363 | WP_012514785.1 | competence type IV pilus minor pilin ComGG | - |
| I2438_RS01030 (HCFMJIKG_00202) | comYH | 162727..163680 (+) | 954 | WP_231146412.1 | class I SAM-dependent methyltransferase | Machinery gene |
Sequence
Protein
Download Length: 63 a.a. Molecular weight: 7206.21 Da Isoelectric Point: 4.1258
>NTDB_id=507742 I2438_RS01000 WP_050316475.1 160785..160976(+) (prx) [Streptococcus equi subsp. zooepidemicus strain SEZ36]
MLTYDEFKQAVDNGYITGDVVMIVRKNGQILDYVLPHESVRAWEVVTVEAVADVLAELYNKEF
MLTYDEFKQAVDNGYITGDVVMIVRKNGQILDYVLPHESVRAWEVVTVEAVADVLAELYNKEF
Nucleotide
Download Length: 192 bp
>NTDB_id=507742 I2438_RS01000 WP_050316475.1 160785..160976(+) (prx) [Streptococcus equi subsp. zooepidemicus strain SEZ36]
ATGCTAACATACGACGAGTTTAAGCAGGCAGTTGATAACGGTTATATCACAGGAGACGTGGTCATGATCGTGCGTAAAAA
CGGACAGATTTTGGATTATGTGTTGCCGCATGAGTCTGTGAGGGCTTGGGAAGTGGTGACAGTCGAGGCAGTAGCTGATG
TTTTAGCTGAATTGTATAACAAAGAATTTTAG
ATGCTAACATACGACGAGTTTAAGCAGGCAGTTGATAACGGTTATATCACAGGAGACGTGGTCATGATCGTGCGTAAAAA
CGGACAGATTTTGGATTATGTGTTGCCGCATGAGTCTGTGAGGGCTTGGGAAGTGGTGACAGTCGAGGCAGTAGCTGATG
TTTTAGCTGAATTGTATAACAAAGAATTTTAG
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS315 |
74.138 |
92.063 |
0.683 |
| prx | Streptococcus pyogenes MGAS8232 |
74.138 |
92.063 |
0.683 |
| prx | Streptococcus pyogenes MGAS315 |
74.138 |
92.063 |
0.683 |
| prx | Streptococcus pyogenes MGAS315 |
70.69 |
92.063 |
0.651 |
| prx | Streptococcus pyogenes MGAS315 |
82.927 |
65.079 |
0.54 |
| prx | Streptococcus pyogenes MGAS315 |
80.952 |
66.667 |
0.54 |
| prx | Streptococcus pyogenes MGAS315 |
73.171 |
65.079 |
0.476 |