Detailed information
Bioinformatically predicted
Overview
| Name | prx | Type | Regulator |
| Locus tag | I2435_RS02725 | Genome accession | NZ_CP065059 |
| Coordinates | 503178..503360 (+) | Length | 60 a.a. |
| NCBI ID | WP_206156615.1 | Uniprot ID | - |
| Organism | Streptococcus equi subsp. zooepidemicus strain SEZ25 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 460059..504468 | 503178..503360 | within | 0 |
Gene organization within MGE regions
Location: 460059..504468
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| I2435_RS02425 (JFMEOBDD_00484) | - | 460059..461225 (-) | 1167 | WP_064056124.1 | site-specific integrase | - |
| I2435_RS02430 (JFMEOBDD_00485) | - | 461399..462073 (-) | 675 | WP_154803906.1 | NYN domain-containing protein | - |
| I2435_RS02435 (JFMEOBDD_00486) | - | 462288..463112 (-) | 825 | WP_206156598.1 | helix-turn-helix transcriptional regulator | - |
| I2435_RS02440 (JFMEOBDD_00487) | - | 463271..463471 (+) | 201 | WP_038433319.1 | helix-turn-helix transcriptional regulator | - |
| I2435_RS02445 (JFMEOBDD_00488) | - | 463599..463805 (+) | 207 | WP_206156599.1 | helix-turn-helix transcriptional regulator | - |
| I2435_RS02450 (JFMEOBDD_00489) | - | 463877..464128 (+) | 252 | WP_161458456.1 | hypothetical protein | - |
| I2435_RS02455 (JFMEOBDD_00490) | - | 464159..464299 (+) | 141 | WP_206156600.1 | hypothetical protein | - |
| I2435_RS02460 (JFMEOBDD_00491) | - | 464280..464456 (+) | 177 | WP_206156601.1 | hypothetical protein | - |
| I2435_RS02465 (JFMEOBDD_00492) | - | 464459..465778 (+) | 1320 | WP_165627055.1 | AAA family ATPase | - |
| I2435_RS02470 (JFMEOBDD_00493) | - | 465794..466873 (+) | 1080 | WP_050315890.1 | ATP-binding protein | - |
| I2435_RS02475 (JFMEOBDD_00494) | - | 466913..467335 (+) | 423 | WP_050315889.1 | hypothetical protein | - |
| I2435_RS02480 (JFMEOBDD_00495) | - | 467337..468071 (+) | 735 | WP_050316125.1 | hypothetical protein | - |
| I2435_RS02485 (JFMEOBDD_00496) | - | 468092..468694 (+) | 603 | WP_050316124.1 | hypothetical protein | - |
| I2435_RS02490 (JFMEOBDD_00497) | - | 468694..470277 (+) | 1584 | WP_050316123.1 | DEAD/DEAH box helicase | - |
| I2435_RS02495 (JFMEOBDD_00498) | - | 470290..472575 (+) | 2286 | WP_206156602.1 | AAA family ATPase | - |
| I2435_RS02500 (JFMEOBDD_00499) | - | 472846..473064 (+) | 219 | WP_050315884.1 | hypothetical protein | - |
| I2435_RS02505 (JFMEOBDD_00500) | - | 473057..473452 (+) | 396 | WP_050315883.1 | RusA family crossover junction endodeoxyribonuclease | - |
| I2435_RS02510 (JFMEOBDD_00501) | - | 473449..473673 (+) | 225 | WP_050315882.1 | hypothetical protein | - |
| I2435_RS02515 (JFMEOBDD_00502) | - | 473676..473879 (+) | 204 | WP_206156603.1 | hypothetical protein | - |
| I2435_RS02520 (JFMEOBDD_00503) | - | 473857..474141 (+) | 285 | WP_050317102.1 | DUF3310 domain-containing protein | - |
| I2435_RS02525 (JFMEOBDD_00504) | - | 474138..474389 (+) | 252 | WP_012678847.1 | hypothetical protein | - |
| I2435_RS02530 (JFMEOBDD_00505) | - | 474373..474765 (+) | 393 | WP_206156604.1 | YopX family protein | - |
| I2435_RS02535 (JFMEOBDD_00506) | - | 474806..475018 (+) | 213 | WP_206156605.1 | hypothetical protein | - |
| I2435_RS02540 (JFMEOBDD_00507) | - | 475023..475223 (+) | 201 | WP_206156606.1 | hypothetical protein | - |
| I2435_RS02545 (JFMEOBDD_00508) | - | 475216..475443 (+) | 228 | WP_206156607.1 | hypothetical protein | - |
| I2435_RS02550 (JFMEOBDD_00509) | - | 475433..476197 (+) | 765 | WP_206156608.1 | site-specific DNA-methyltransferase | - |
| I2435_RS02555 (JFMEOBDD_00510) | - | 476246..476602 (+) | 357 | Protein_446 | DUF1642 domain-containing protein | - |
| I2435_RS02560 (JFMEOBDD_00511) | - | 476779..477087 (+) | 309 | WP_206156609.1 | hypothetical protein | - |
| I2435_RS02565 (JFMEOBDD_00512) | - | 477087..477302 (+) | 216 | WP_050317032.1 | hypothetical protein | - |
| I2435_RS02570 (JFMEOBDD_00513) | - | 477378..477812 (+) | 435 | WP_050315875.1 | ArpU family phage packaging/lysis transcriptional regulator | - |
| I2435_RS02575 (JFMEOBDD_00514) | - | 478219..478596 (-) | 378 | WP_012679314.1 | type II toxin-antitoxin system HicB family antitoxin | - |
| I2435_RS02580 (JFMEOBDD_00515) | - | 478648..478833 (-) | 186 | WP_012679315.1 | type II toxin-antitoxin system HicA family toxin | - |
| I2435_RS02585 (JFMEOBDD_00516) | - | 478949..479284 (+) | 336 | WP_012679316.1 | HNH endonuclease signature motif containing protein | - |
| I2435_RS02590 (JFMEOBDD_00517) | - | 479447..479914 (+) | 468 | WP_206156610.1 | phage terminase small subunit P27 family | - |
| I2435_RS02595 (JFMEOBDD_00518) | - | 479929..481683 (+) | 1755 | WP_050319690.1 | terminase TerL endonuclease subunit | - |
| I2435_RS02600 (JFMEOBDD_00519) | - | 481680..481850 (+) | 171 | WP_012679318.1 | hypothetical protein | - |
| I2435_RS02605 (JFMEOBDD_00520) | - | 481843..482109 (+) | 267 | WP_206156611.1 | hypothetical protein | - |
| I2435_RS02610 (JFMEOBDD_00521) | - | 482143..483363 (+) | 1221 | WP_012679320.1 | phage portal protein | - |
| I2435_RS02615 (JFMEOBDD_00522) | - | 483341..484006 (+) | 666 | WP_012679321.1 | head maturation protease, ClpP-related | - |
| I2435_RS02620 (JFMEOBDD_00523) | - | 484031..485218 (+) | 1188 | WP_012679322.1 | phage major capsid protein | - |
| I2435_RS10280 | - | 485232..485360 (+) | 129 | WP_012679323.1 | hypothetical protein | - |
| I2435_RS02625 (JFMEOBDD_00524) | - | 485363..485665 (+) | 303 | WP_012679324.1 | head-tail connector protein | - |
| I2435_RS02630 (JFMEOBDD_00525) | - | 485662..486009 (+) | 348 | WP_012679325.1 | phage head closure protein | - |
| I2435_RS02635 (JFMEOBDD_00526) | - | 486006..486383 (+) | 378 | WP_012679326.1 | HK97-gp10 family putative phage morphogenesis protein | - |
| I2435_RS02640 (JFMEOBDD_00527) | - | 486380..486805 (+) | 426 | WP_050315850.1 | hypothetical protein | - |
| I2435_RS02645 (JFMEOBDD_00528) | - | 486821..487411 (+) | 591 | WP_012679328.1 | major tail protein | - |
| I2435_RS02650 (JFMEOBDD_00529) | - | 487463..487789 (+) | 327 | WP_012679329.1 | hypothetical protein | - |
| I2435_RS02655 | - | 487837..487986 (+) | 150 | WP_021299462.1 | hypothetical protein | - |
| I2435_RS02660 (JFMEOBDD_00530) | - | 487999..491658 (+) | 3660 | WP_206156612.1 | phage tail tape measure protein | - |
| I2435_RS02665 (JFMEOBDD_00531) | - | 491658..492365 (+) | 708 | WP_012679331.1 | distal tail protein Dit | - |
| I2435_RS02670 (JFMEOBDD_00532) | - | 492362..494500 (+) | 2139 | WP_206156613.1 | phage tail spike protein | - |
| I2435_RS02675 (JFMEOBDD_00533) | - | 494497..495612 (+) | 1116 | WP_050315855.1 | hyaluronoglucosaminidase | - |
| I2435_RS02680 (JFMEOBDD_00534) | - | 495631..497514 (+) | 1884 | WP_206156614.1 | gp58-like family protein | - |
| I2435_RS02685 (JFMEOBDD_00535) | - | 497523..497954 (+) | 432 | WP_012679336.1 | DUF1617 family protein | - |
| I2435_RS02690 (JFMEOBDD_00536) | - | 497957..498571 (+) | 615 | WP_012679337.1 | DUF1366 domain-containing protein | - |
| I2435_RS02695 (JFMEOBDD_00537) | - | 498584..498874 (+) | 291 | WP_012679338.1 | hypothetical protein | - |
| I2435_RS02700 (JFMEOBDD_00538) | - | 498877..499056 (+) | 180 | WP_012679339.1 | holin | - |
| I2435_RS02705 (JFMEOBDD_00540) | - | 499168..500364 (+) | 1197 | WP_012679341.1 | glucosaminidase domain-containing protein | - |
| I2435_RS02710 (JFMEOBDD_00541) | - | 500499..501041 (+) | 543 | WP_012679342.1 | type II toxin-antitoxin system antitoxin SocA domain-containing protein | - |
| I2435_RS02715 (JFMEOBDD_00542) | - | 501045..501881 (+) | 837 | WP_012679343.1 | hypothetical protein | - |
| I2435_RS02720 (JFMEOBDD_00543) | - | 502254..502829 (+) | 576 | WP_012679345.1 | phospholipase A2 SlaA | - |
| I2435_RS10150 (JFMEOBDD_00544) | - | 502823..503110 (+) | 288 | WP_011106694.1 | hypothetical protein | - |
| I2435_RS02725 (JFMEOBDD_00545) | prx | 503178..503360 (+) | 183 | WP_206156615.1 | Paratox | Regulator |
| I2435_RS02730 (JFMEOBDD_00546) | - | 503500..504468 (+) | 969 | WP_206156616.1 | DNA-binding protein | - |
Sequence
Protein
Download Length: 60 a.a. Molecular weight: 7041.92 Da Isoelectric Point: 4.0606
>NTDB_id=506480 I2435_RS02725 WP_206156615.1 503178..503360(+) (prx) [Streptococcus equi subsp. zooepidemicus strain SEZ25]
MLTYDEFKQAVDNGYITGDTVTIVRKNGQILDYVLPHEEVQPWEVVTEEKVEEVMRELDK
MLTYDEFKQAVDNGYITGDTVTIVRKNGQILDYVLPHEEVQPWEVVTEEKVEEVMRELDK
Nucleotide
Download Length: 183 bp
>NTDB_id=506480 I2435_RS02725 WP_206156615.1 503178..503360(+) (prx) [Streptococcus equi subsp. zooepidemicus strain SEZ25]
ATGCTAACATACGACGAATTTAAGCAGGCAGTTGATAACGGTTATATCACAGGCGACACAGTCACGATCGTGCGTAAAAA
CGGACAGATTTTGGATTATGTGTTGCCGCATGAGGAAGTGCAGCCTTGGGAAGTGGTGACCGAGGAAAAAGTGGAAGAGG
TGATGAGAGAATTAGACAAATAA
ATGCTAACATACGACGAATTTAAGCAGGCAGTTGATAACGGTTATATCACAGGCGACACAGTCACGATCGTGCGTAAAAA
CGGACAGATTTTGGATTATGTGTTGCCGCATGAGGAAGTGCAGCCTTGGGAAGTGGTGACCGAGGAAAAAGTGGAAGAGG
TGATGAGAGAATTAGACAAATAA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS315 |
80 |
100 |
0.8 |
| prx | Streptococcus pyogenes MGAS315 |
80 |
100 |
0.8 |
| prx | Streptococcus pyogenes MGAS315 |
76.667 |
100 |
0.767 |
| prx | Streptococcus pyogenes MGAS8232 |
76.667 |
100 |
0.767 |
| prx | Streptococcus pyogenes MGAS315 |
71.667 |
100 |
0.717 |
| prx | Streptococcus pyogenes MGAS315 |
82.927 |
68.333 |
0.567 |
| prx | Streptococcus pyogenes MGAS315 |
73.171 |
68.333 |
0.5 |