Detailed information
Bioinformatically predicted
Overview
| Name | prx | Type | Regulator |
| Locus tag | I2433_RS05680 | Genome accession | NZ_CP065056 |
| Coordinates | 1166872..1167060 (-) | Length | 62 a.a. |
| NCBI ID | WP_043983595.1 | Uniprot ID | - |
| Organism | Streptococcus equi subsp. zooepidemicus strain SEZ14 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1140154..1202321 | 1166872..1167060 | within | 0 |
Gene organization within MGE regions
Location: 1140154..1202321
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| I2433_RS05545 (JDBNIEOD_01111) | - | 1140154..1140855 (-) | 702 | WP_206151909.1 | ABC transporter ATP-binding protein | - |
| I2433_RS05550 (JDBNIEOD_01112) | - | 1140978..1141526 (+) | 549 | WP_021320697.1 | TetR family transcriptional regulator | - |
| I2433_RS05555 (JDBNIEOD_01113) | - | 1141643..1142284 (-) | 642 | WP_012678034.1 | TrkA C-terminal domain-containing protein | - |
| I2433_RS05560 (JDBNIEOD_01114) | - | 1142442..1142930 (-) | 489 | WP_012515526.1 | Asp23/Gls24 family envelope stress response protein | - |
| I2433_RS05565 (JDBNIEOD_01115) | - | 1142940..1143137 (-) | 198 | WP_012678035.1 | CsbD family protein | - |
| I2433_RS05570 (JDBNIEOD_01116) | - | 1143175..1143714 (-) | 540 | WP_012515524.1 | Asp23/Gls24 family envelope stress response protein | - |
| I2433_RS05575 (JDBNIEOD_01117) | - | 1143727..1143915 (-) | 189 | WP_012515523.1 | DUF2273 domain-containing protein | - |
| I2433_RS05580 (JDBNIEOD_01118) | amaP | 1143925..1144506 (-) | 582 | WP_111678044.1 | alkaline shock response membrane anchor protein AmaP | - |
| I2433_RS05585 (JDBNIEOD_01119) | - | 1144554..1144799 (-) | 246 | WP_021320695.1 | GlsB/YeaQ/YmgE family stress response membrane protein | - |
| I2433_RS05590 (JDBNIEOD_01120) | pcrA | 1145212..1147503 (-) | 2292 | WP_206151910.1 | DNA helicase PcrA | - |
| I2433_RS05595 (JDBNIEOD_01121) | - | 1147717..1148880 (+) | 1164 | WP_206151911.1 | IS30-like element ISSeq6 family transposase | - |
| I2433_RS05600 (JDBNIEOD_01122) | - | 1149533..1150867 (+) | 1335 | WP_206151912.1 | sodium:alanine symporter family protein | - |
| I2433_RS05605 (JDBNIEOD_01123) | - | 1150970..1152208 (+) | 1239 | WP_206151913.1 | cation diffusion facilitator family transporter | - |
| I2433_RS05610 (JDBNIEOD_01124) | - | 1152304..1153140 (-) | 837 | WP_206151914.1 | amino acid ABC transporter substrate-binding protein | - |
| I2433_RS05615 (JDBNIEOD_01125) | - | 1153157..1153786 (-) | 630 | WP_012515516.1 | amino acid ABC transporter ATP-binding protein | - |
| I2433_RS05620 (JDBNIEOD_01126) | - | 1153796..1154437 (-) | 642 | WP_206151915.1 | amino acid ABC transporter permease | - |
| I2433_RS05625 (JDBNIEOD_01127) | - | 1154544..1154879 (-) | 336 | WP_021320691.1 | zinc ribbon domain-containing protein YjdM | - |
| I2433_RS05630 (JDBNIEOD_01128) | glmS | 1155063..1156874 (-) | 1812 | WP_206151916.1 | glutamine--fructose-6-phosphate transaminase (isomerizing) | - |
| I2433_RS05635 (JDBNIEOD_01129) | lepB | 1157051..1157608 (-) | 558 | WP_012678044.1 | signal peptidase I | - |
| I2433_RS05640 (JDBNIEOD_01130) | pyk | 1157737..1159239 (-) | 1503 | WP_012515511.1 | pyruvate kinase | - |
| I2433_RS05645 (JDBNIEOD_01131) | pfkA | 1159301..1160314 (-) | 1014 | WP_012515510.1 | 6-phosphofructokinase | - |
| I2433_RS05650 (JDBNIEOD_01132) | - | 1160394..1163504 (-) | 3111 | WP_206151917.1 | DNA polymerase III subunit alpha | - |
| I2433_RS05655 (JDBNIEOD_01133) | - | 1163746..1164117 (+) | 372 | WP_012515508.1 | GntR family transcriptional regulator | - |
| I2433_RS05660 (JDBNIEOD_01134) | - | 1164117..1164815 (+) | 699 | WP_111678035.1 | ABC transporter ATP-binding protein | - |
| I2433_RS05665 (JDBNIEOD_01135) | - | 1164825..1165619 (+) | 795 | WP_043025739.1 | hypothetical protein | - |
| I2433_RS05670 (JDBNIEOD_01136) | - | 1165666..1166277 (-) | 612 | WP_043025737.1 | TVP38/TMEM64 family protein | - |
| I2433_RS05680 (JDBNIEOD_01138) | prx | 1166872..1167060 (-) | 189 | WP_043983595.1 | Paratox | Regulator |
| I2433_RS10520 (JDBNIEOD_01139) | - | 1167129..1167416 (-) | 288 | WP_011106694.1 | hypothetical protein | - |
| I2433_RS05685 (JDBNIEOD_01140) | - | 1167410..1167985 (-) | 576 | WP_012679345.1 | phospholipase A2 SlaA | - |
| I2433_RS05690 (JDBNIEOD_01141) | - | 1168366..1169577 (-) | 1212 | WP_165619564.1 | glucosaminidase domain-containing protein | - |
| I2433_RS05695 (JDBNIEOD_01142) | - | 1169689..1169868 (-) | 180 | WP_064056104.1 | hypothetical protein | - |
| I2433_RS05700 (JDBNIEOD_01143) | - | 1169871..1170161 (-) | 291 | WP_012679338.1 | hypothetical protein | - |
| I2433_RS05705 (JDBNIEOD_01144) | - | 1170174..1170785 (-) | 612 | WP_165619565.1 | DUF1366 domain-containing protein | - |
| I2433_RS05710 (JDBNIEOD_01145) | - | 1170789..1171220 (-) | 432 | WP_165619566.1 | DUF1617 family protein | - |
| I2433_RS05715 (JDBNIEOD_01146) | - | 1171229..1173133 (-) | 1905 | WP_165619567.1 | gp58-like family protein | - |
| I2433_RS05720 (JDBNIEOD_01147) | - | 1173144..1173761 (-) | 618 | WP_165619568.1 | hypothetical protein | - |
| I2433_RS05725 (JDBNIEOD_01148) | - | 1173763..1174647 (-) | 885 | WP_165619569.1 | collagen-like protein | - |
| I2433_RS05730 (JDBNIEOD_01149) | - | 1174644..1176695 (-) | 2052 | WP_206151918.1 | phage tail spike protein | - |
| I2433_RS05735 (JDBNIEOD_01150) | - | 1176692..1177402 (-) | 711 | WP_050316215.1 | phage tail domain-containing protein | - |
| I2433_RS05740 (JDBNIEOD_01151) | - | 1177399..1180536 (-) | 3138 | WP_165619545.1 | phage tail tape measure protein | - |
| I2433_RS05745 (JDBNIEOD_01152) | - | 1180610..1180768 (-) | 159 | WP_002986162.1 | hypothetical protein | - |
| I2433_RS05750 (JDBNIEOD_01153) | - | 1180804..1181175 (-) | 372 | WP_165619544.1 | hypothetical protein | - |
| I2433_RS05755 (JDBNIEOD_01154) | - | 1181196..1181783 (-) | 588 | WP_003057267.1 | hypothetical protein | - |
| I2433_RS05760 (JDBNIEOD_01155) | - | 1181794..1182216 (-) | 423 | WP_050316223.1 | hypothetical protein | - |
| I2433_RS05765 (JDBNIEOD_01156) | - | 1182225..1182596 (-) | 372 | WP_165619543.1 | hypothetical protein | - |
| I2433_RS05770 (JDBNIEOD_01157) | - | 1182568..1182945 (-) | 378 | WP_050316225.1 | hypothetical protein | - |
| I2433_RS05775 (JDBNIEOD_01158) | - | 1182947..1183240 (-) | 294 | WP_050316226.1 | phage gp6-like head-tail connector protein | - |
| I2433_RS05780 (JDBNIEOD_01159) | - | 1183260..1183547 (-) | 288 | WP_165619542.1 | HeH/LEM domain-containing protein | - |
| I2433_RS05785 (JDBNIEOD_01160) | - | 1183562..1184755 (-) | 1194 | WP_050316228.1 | phage major capsid protein | - |
| I2433_RS05790 (JDBNIEOD_01161) | - | 1184792..1185508 (-) | 717 | WP_050316229.1 | head maturation protease, ClpP-related | - |
| I2433_RS05795 (JDBNIEOD_01162) | - | 1185512..1186747 (-) | 1236 | WP_050316230.1 | phage portal protein | - |
| I2433_RS05800 (JDBNIEOD_01163) | - | 1186765..1186944 (-) | 180 | WP_165619584.1 | hypothetical protein | - |
| I2433_RS05805 (JDBNIEOD_01164) | - | 1186941..1188599 (-) | 1659 | WP_165619585.1 | terminase TerL endonuclease subunit | - |
| I2433_RS05810 (JDBNIEOD_01165) | - | 1188580..1188927 (-) | 348 | WP_002986187.1 | hypothetical protein | - |
| I2433_RS05815 (JDBNIEOD_01166) | - | 1189049..1189378 (-) | 330 | WP_165619586.1 | HNH endonuclease | - |
| I2433_RS05820 (JDBNIEOD_01167) | - | 1189375..1189671 (-) | 297 | WP_050316235.1 | hypothetical protein | - |
| I2433_RS05825 (JDBNIEOD_01168) | - | 1189842..1190405 (-) | 564 | WP_206152563.1 | site-specific integrase | - |
| I2433_RS05830 (JDBNIEOD_01169) | - | 1190500..1190919 (-) | 420 | WP_206151919.1 | DUF1492 domain-containing protein | - |
| I2433_RS05835 (JDBNIEOD_01170) | - | 1190943..1191143 (-) | 201 | WP_165619580.1 | hypothetical protein | - |
| I2433_RS05840 (JDBNIEOD_01171) | - | 1191165..1191380 (-) | 216 | WP_165619579.1 | hypothetical protein | - |
| I2433_RS05845 (JDBNIEOD_01172) | - | 1191377..1191544 (-) | 168 | WP_165619578.1 | hypothetical protein | - |
| I2433_RS05850 (JDBNIEOD_01173) | - | 1191541..1192119 (-) | 579 | WP_206151920.1 | DUF1642 domain-containing protein | - |
| I2433_RS05855 (JDBNIEOD_01174) | - | 1192109..1193326 (-) | 1218 | WP_206151921.1 | DNA cytosine methyltransferase | - |
| I2433_RS05860 (JDBNIEOD_01175) | - | 1193326..1194021 (-) | 696 | WP_165619581.1 | site-specific DNA-methyltransferase | - |
| I2433_RS05865 (JDBNIEOD_01176) | - | 1194032..1194259 (-) | 228 | WP_165619576.1 | hypothetical protein | - |
| I2433_RS05870 (JDBNIEOD_01177) | - | 1194270..1194473 (-) | 204 | WP_230923494.1 | hypothetical protein | - |
| I2433_RS05875 (JDBNIEOD_01178) | - | 1194473..1194754 (-) | 282 | WP_165619575.1 | hypothetical protein | - |
| I2433_RS05880 (JDBNIEOD_01179) | - | 1194767..1194904 (-) | 138 | WP_165619574.1 | hypothetical protein | - |
| I2433_RS05885 (JDBNIEOD_01180) | - | 1194895..1195677 (-) | 783 | WP_043983621.1 | ATP-binding protein | - |
| I2433_RS05890 (JDBNIEOD_01181) | - | 1195664..1196476 (-) | 813 | WP_050316935.1 | phage replisome organizer N-terminal domain-containing protein | - |
| I2433_RS05895 (JDBNIEOD_01183) | - | 1196622..1196912 (-) | 291 | WP_037578536.1 | MerR family transcriptional regulator | - |
| I2433_RS05900 (JDBNIEOD_01185) | - | 1197128..1197856 (-) | 729 | WP_165619573.1 | phage antirepressor KilAC domain-containing protein | - |
| I2433_RS05905 (JDBNIEOD_01186) | - | 1197896..1198102 (-) | 207 | WP_001157159.1 | helix-turn-helix transcriptional regulator | - |
| I2433_RS05910 (JDBNIEOD_01187) | - | 1198155..1198700 (+) | 546 | WP_196820048.1 | hypothetical protein | - |
| I2433_RS05915 (JDBNIEOD_01188) | - | 1198659..1198871 (-) | 213 | WP_165619597.1 | hypothetical protein | - |
| I2433_RS05920 (JDBNIEOD_01189) | - | 1198908..1199066 (-) | 159 | WP_003056201.1 | hypothetical protein | - |
| I2433_RS05925 (JDBNIEOD_01191) | - | 1199455..1200222 (+) | 768 | WP_165619598.1 | S24 family peptidase | - |
| I2433_RS05930 (JDBNIEOD_01192) | - | 1200437..1201111 (+) | 675 | WP_154803906.1 | NYN domain-containing protein | - |
| I2433_RS05935 (JDBNIEOD_01193) | - | 1201233..1202321 (+) | 1089 | WP_165619599.1 | site-specific integrase | - |
Sequence
Protein
Download Length: 62 a.a. Molecular weight: 7221.23 Da Isoelectric Point: 5.0079
>NTDB_id=506375 I2433_RS05680 WP_043983595.1 1166872..1167060(-) (prx) [Streptococcus equi subsp. zooepidemicus strain SEZ14]
MLTYDEFKQAIDHGYITGDTVAIVRKNGQIFDYVLPHESVRSWEVVTEERVEAVLKELHCIK
MLTYDEFKQAIDHGYITGDTVAIVRKNGQIFDYVLPHESVRSWEVVTEERVEAVLKELHCIK
Nucleotide
Download Length: 189 bp
>NTDB_id=506375 I2433_RS05680 WP_043983595.1 1166872..1167060(-) (prx) [Streptococcus equi subsp. zooepidemicus strain SEZ14]
GTGTTAACATACGACGAGTTTAAGCAGGCTATTGATCATGGTTATATCACAGGAGACACAGTAGCGATTGTGCGCAAAAA
CGGACAGATTTTTGATTATGTGTTGCCGCATGAGTCTGTGAGATCGTGGGAGGTTGTGACTGAAGAAAGAGTAGAAGCAG
TACTAAAAGAATTACACTGTATTAAATGA
GTGTTAACATACGACGAGTTTAAGCAGGCTATTGATCATGGTTATATCACAGGAGACACAGTAGCGATTGTGCGCAAAAA
CGGACAGATTTTTGATTATGTGTTGCCGCATGAGTCTGTGAGATCGTGGGAGGTTGTGACTGAAGAAAGAGTAGAAGCAG
TACTAAAAGAATTACACTGTATTAAATGA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS315 |
82.759 |
93.548 |
0.774 |
| prx | Streptococcus pyogenes MGAS315 |
82.759 |
93.548 |
0.774 |
| prx | Streptococcus pyogenes MGAS8232 |
81.034 |
93.548 |
0.758 |
| prx | Streptococcus pyogenes MGAS315 |
74.576 |
95.161 |
0.71 |
| prx | Streptococcus pyogenes MGAS315 |
88.095 |
67.742 |
0.597 |
| prx | Streptococcus pyogenes MGAS315 |
85.714 |
67.742 |
0.581 |
| prx | Streptococcus pyogenes MGAS315 |
80.952 |
67.742 |
0.548 |