Detailed information    

insolico Bioinformatically predicted

Overview


Name   ssbA   Type   Machinery gene
Locus tag   IUJ40_RS03775 Genome accession   NZ_CP064389
Coordinates   746543..747013 (+) Length   156 a.a.
NCBI ID   WP_000934764.1    Uniprot ID   A0A9P4DKA4
Organism   Staphylococcus aureus strain PartE-Saureus-RM8376     
Function   ssDNA binding (predicted from homology)   
DNA processing

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 716150..778681 746543..747013 within 0


Gene organization within MGE regions


Location: 716150..778681
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  IUJ40_RS03575 (IUJ40_03575) - 716150..716776 (-) 627 WP_000522384.1 nitroreductase family protein -
  IUJ40_RS03580 (IUJ40_03580) - 716973..718232 (+) 1260 WP_000120305.1 SdrH family protein -
  IUJ40_RS03585 (IUJ40_03585) mroQ 718257..719000 (-) 744 WP_000197635.1 CPBP family intramembrane glutamic endopeptidase MroQ -
  IUJ40_RS03590 (IUJ40_03590) groES 719175..719459 (+) 285 WP_000917289.1 co-chaperone GroES -
  IUJ40_RS03595 (IUJ40_03595) groL 719535..721151 (+) 1617 WP_000240645.1 chaperonin GroEL -
  IUJ40_RS03600 (IUJ40_03600) - 721246..721792 (-) 547 Protein_703 site-specific integrase -
  IUJ40_RS03605 (IUJ40_03605) - 721853..722065 (+) 213 WP_000128898.1 LuxR C-terminal-related transcriptional regulator -
  IUJ40_RS03610 (IUJ40_03610) - 722062..722652 (+) 591 WP_001293058.1 terminase small subunit -
  IUJ40_RS03615 (IUJ40_03615) - 722970..723407 (+) 438 WP_011447041.1 hypothetical protein -
  IUJ40_RS03620 (IUJ40_03620) - 723602..724774 (-) 1173 WP_000195429.1 IS256-like element IS256 family transposase -
  IUJ40_RS03625 (IUJ40_03625) - 724830..725288 (+) 459 WP_065252084.1 GNAT family N-acetyltransferase -
  IUJ40_RS03630 (IUJ40_03630) - 726141..727448 (-) 1308 WP_001045079.1 TrkH family potassium uptake protein -
  IUJ40_RS03635 (IUJ40_03635) - 727609..728520 (+) 912 WP_000825510.1 iron-hydroxamate ABC transporter substrate-binding protein -
  IUJ40_RS03640 (IUJ40_03640) - 728582..729427 (+) 846 WP_111187741.1 class I SAM-dependent methyltransferase -
  IUJ40_RS03645 (IUJ40_03645) - 729799..731022 (-) 1224 WP_000206638.1 ArgE/DapE family deacylase -
  IUJ40_RS03650 (IUJ40_03650) lukH 731457..732512 (+) 1056 WP_000791407.1 bi-component leukocidin LukGH subunit H -
  IUJ40_RS03655 (IUJ40_03655) lukG 732534..733547 (+) 1014 WP_023487212.1 bi-component leukocidin LukGH subunit G -
  IUJ40_RS03660 (IUJ40_03660) sph 733785..734609 (-) 825 Protein_715 sphingomyelin phosphodiesterase -
  IUJ40_RS03665 (IUJ40_03665) - 734666..735703 (-) 1038 WP_065252081.1 site-specific integrase -
  IUJ40_RS03670 (IUJ40_03670) - 735762..736226 (-) 465 WP_000825947.1 hypothetical protein -
  IUJ40_RS03675 (IUJ40_03675) - 736326..736508 (-) 183 WP_000705248.1 hypothetical protein -
  IUJ40_RS03680 (IUJ40_03680) - 736712..737053 (-) 342 WP_000591749.1 hypothetical protein -
  IUJ40_RS03685 (IUJ40_03685) - 737059..737991 (-) 933 WP_000759682.1 exonuclease domain-containing protein -
  IUJ40_RS03690 (IUJ40_03690) - 738007..738720 (-) 714 WP_001031454.1 XRE family transcriptional regulator -
  IUJ40_RS03695 (IUJ40_03695) - 738683..738856 (+) 174 WP_001801500.1 hypothetical protein -
  IUJ40_RS03700 (IUJ40_03700) - 738853..739116 (+) 264 WP_000854072.1 helix-turn-helix transcriptional regulator -
  IUJ40_RS03705 (IUJ40_03705) - 739132..739347 (+) 216 WP_001025874.1 MW1434 family type I TA system toxin -
  IUJ40_RS03710 (IUJ40_03710) - 739336..739665 (-) 330 WP_065252080.1 hypothetical protein -
  IUJ40_RS03715 (IUJ40_03715) - 739716..740468 (+) 753 WP_001148605.1 phage antirepressor KilAC domain-containing protein -
  IUJ40_RS03720 (IUJ40_03720) - 740484..740681 (+) 198 WP_001148855.1 hypothetical protein -
  IUJ40_RS03725 (IUJ40_03725) - 740712..740852 (+) 141 WP_000939496.1 hypothetical protein -
  IUJ40_RS03730 (IUJ40_03730) - 740867..741499 (-) 633 WP_000275058.1 hypothetical protein -
  IUJ40_RS03735 (IUJ40_03735) - 741558..741878 (+) 321 WP_001120197.1 DUF771 domain-containing protein -
  IUJ40_RS03740 (IUJ40_03740) - 741875..742036 (+) 162 WP_000066017.1 DUF1270 domain-containing protein -
  IUJ40_RS03745 (IUJ40_03745) - 742131..742457 (+) 327 WP_000165375.1 DUF2482 family protein -
  IUJ40_RS03750 (IUJ40_03750) - 742438..742698 (+) 261 WP_000291503.1 DUF1108 family protein -
  IUJ40_RS03755 (IUJ40_03755) - 742707..742970 (+) 264 WP_001205732.1 hypothetical protein -
  IUJ40_RS03760 (IUJ40_03760) - 742979..744922 (+) 1944 WP_000700577.1 AAA family ATPase -
  IUJ40_RS03765 (IUJ40_03765) - 744924..745844 (+) 921 WP_000138472.1 recombinase RecT -
  IUJ40_RS03770 (IUJ40_03770) - 745925..746542 (+) 618 WP_071621397.1 MBL fold metallo-hydrolase -
  IUJ40_RS03775 (IUJ40_03775) ssbA 746543..747013 (+) 471 WP_000934764.1 single-stranded DNA-binding protein Machinery gene
  IUJ40_RS03780 (IUJ40_03780) - 747043..747916 (+) 874 Protein_739 DnaD domain protein -
  IUJ40_RS03785 (IUJ40_03785) - 747923..748141 (+) 219 WP_000338531.1 hypothetical protein -
  IUJ40_RS03790 (IUJ40_03790) - 748150..748459 (+) 310 Protein_741 RusA family crossover junction endodeoxyribonuclease -
  IUJ40_RS03795 (IUJ40_03795) - 748472..748840 (+) 369 WP_000101274.1 SA1788 family PVL leukocidin-associated protein -
  IUJ40_RS03800 (IUJ40_03800) - 748844..749086 (+) 243 WP_000131366.1 SAV1978 family virulence-associated passenger protein -
  IUJ40_RS03805 (IUJ40_03805) - 749101..749265 (+) 165 WP_000990744.1 hypothetical protein -
  IUJ40_RS03810 (IUJ40_03810) - 749258..749509 (+) 252 WP_001065091.1 DUF1024 family protein -
  IUJ40_RS03815 (IUJ40_03815) - 749499..749681 (+) 183 WP_000028422.1 hypothetical protein -
  IUJ40_RS03820 (IUJ40_03820) - 749674..750216 (+) 543 WP_000185659.1 dUTP diphosphatase -
  IUJ40_RS03825 (IUJ40_03825) - 750253..750459 (+) 207 WP_000195803.1 DUF1381 domain-containing protein -
  IUJ40_RS03830 (IUJ40_03830) - 750456..750842 (+) 387 WP_000592207.1 hypothetical protein -
  IUJ40_RS03835 (IUJ40_03835) rinB 750839..750988 (+) 150 WP_000595265.1 transcriptional activator RinB -
  IUJ40_RS03840 (IUJ40_03840) - 750988..751188 (+) 201 WP_000265043.1 DUF1514 family protein -
  IUJ40_RS03845 (IUJ40_03845) - 751216..751632 (+) 417 WP_000590122.1 hypothetical protein -
  IUJ40_RS03850 (IUJ40_03850) - 751864..752163 (+) 300 WP_000988336.1 HNH endonuclease -
  IUJ40_RS03855 (IUJ40_03855) - 752293..752637 (+) 345 WP_000402904.1 hypothetical protein -
  IUJ40_RS03860 (IUJ40_03860) - 752634..754295 (+) 1662 WP_000625088.1 terminase large subunit -
  IUJ40_RS03865 (IUJ40_03865) - 754311..755498 (+) 1188 WP_000025274.1 phage portal protein -
  IUJ40_RS03870 (IUJ40_03870) - 755482..756219 (+) 738 WP_065252079.1 head maturation protease, ClpP-related -
  IUJ40_RS03875 (IUJ40_03875) - 756243..757388 (+) 1146 WP_000154559.1 phage major capsid protein -
  IUJ40_RS03880 (IUJ40_03880) - 757408..757692 (+) 285 WP_000238236.1 hypothetical protein -
  IUJ40_RS03885 (IUJ40_03885) - 757682..757966 (+) 285 WP_000150936.1 phage head-tail adapter protein -
  IUJ40_RS03890 (IUJ40_03890) - 757950..758312 (+) 363 WP_000755150.1 head-tail adaptor protein -
  IUJ40_RS03895 (IUJ40_03895) - 758309..758713 (+) 405 WP_000114226.1 HK97 gp10 family phage protein -
  IUJ40_RS03900 (IUJ40_03900) - 758710..759117 (+) 408 WP_000565498.1 hypothetical protein -
  IUJ40_RS03905 (IUJ40_03905) - 759118..759762 (+) 645 WP_000268735.1 major tail protein -
  IUJ40_RS03910 (IUJ40_03910) - 759816..760028 (+) 213 WP_078101489.1 Ig-like domain-containing protein -
  IUJ40_RS03915 (IUJ40_03915) gpG 760078..760428 (+) 351 WP_001096355.1 phage tail assembly chaperone G -
  IUJ40_RS15150 gpGT 760479..760616 (+) 138 WP_001549167.1 phage tail assembly chaperone GT -
  IUJ40_RS03920 (IUJ40_03920) - 760673..765202 (+) 4530 WP_001643732.1 phage tail tape measure protein -
  IUJ40_RS03925 (IUJ40_03925) - 765199..766683 (+) 1485 WP_000567413.1 phage distal tail protein -
  IUJ40_RS03930 (IUJ40_03930) - 766699..770484 (+) 3786 WP_000582190.1 phage tail spike protein -
  IUJ40_RS03935 (IUJ40_03935) - 770474..770626 (+) 153 WP_001153681.1 hypothetical protein -
  IUJ40_RS03940 (IUJ40_03940) - 770673..770960 (+) 288 WP_001040259.1 hypothetical protein -
  IUJ40_RS03945 (IUJ40_03945) - 771016..771390 (+) 375 WP_000340977.1 hypothetical protein -
  IUJ40_RS03950 (IUJ40_03950) sea 771811..772584 (+) 774 WP_000750406.1 staphylococcal enterotoxin type A -
  IUJ40_RS03955 (IUJ40_03955) pepG1 772735..772869 (+) 135 WP_000226108.1 type I toxin-antitoxin system toxin PepG1 -
  IUJ40_RS03960 (IUJ40_03960) - 772922..773029 (-) 108 WP_001791821.1 hypothetical protein -
  IUJ40_RS03965 (IUJ40_03965) - 773081..773335 (+) 255 WP_000611512.1 phage holin -
  IUJ40_RS03970 (IUJ40_03970) - 773347..774102 (+) 756 WP_000861038.1 CHAP domain-containing protein -
  IUJ40_RS03975 (IUJ40_03975) sak 774293..774784 (+) 492 WP_000919350.1 staphylokinase -
  IUJ40_RS03980 (IUJ40_03980) - 775431..775769 (+) 339 Protein_780 SH3 domain-containing protein -
  IUJ40_RS03985 (IUJ40_03985) - 775864..776313 (-) 450 WP_000727649.1 chemotaxis-inhibiting protein CHIPS -
  IUJ40_RS03990 (IUJ40_03990) - 776556..777728 (+) 1173 WP_000195429.1 IS256-like element IS256 family transposase -
  IUJ40_RS03995 (IUJ40_03995) scn 778331..778681 (+) 351 WP_000702263.1 complement inhibitor SCIN-A -

Sequence


Protein


Download         Length: 156 a.a.        Molecular weight: 17627.49 Da        Isoelectric Point: 5.2672

>NTDB_id=501567 IUJ40_RS03775 WP_000934764.1 746543..747013(+) (ssbA) [Staphylococcus aureus strain PartE-Saureus-RM8376]
MLNRTILVGRLTRDPELRTTQSGVNVASFTLAVNRTFTNAQGEREADFINIIVFKKQAENVNKYLSKGSLAGVDGRLQTR
NYENKEGQRVYVTEVVADSIQFLEPKNSNDTQQDLYQQQVQQTRGQSQYSNNKPVKDNPFANANGPIELNDDDLPF

Nucleotide


Download         Length: 471 bp        

>NTDB_id=501567 IUJ40_RS03775 WP_000934764.1 746543..747013(+) (ssbA) [Staphylococcus aureus strain PartE-Saureus-RM8376]
ATGCTAAACAGAACAATATTAGTTGGTCGTTTAACTAGAGACCCAGAATTAAGAACCACTCAAAGTGGTGTAAATGTAGC
ATCATTCACATTAGCAGTTAACCGCACATTTACGAATGCACAAGGAGAGCGCGAGGCAGACTTTATTAATATCATCGTAT
TTAAAAAACAAGCAGAGAACGTTAATAAATACCTATCTAAAGGATCGTTGGCGGGCGTAGATGGTAGGTTACAAACGCGG
AACTATGAAAATAAGGAAGGTCAACGTGTATACGTTACGGAAGTTGTTGCCGATAGTATTCAATTTTTAGAACCGAAGAA
CTCAAATGACACTCAACAAGATTTATATCAACAACAAGTACAACAAACACGTGGACAATCGCAATATTCAAATAACAAAC
CAGTAAAAGATAATCCGTTTGCGAATGCAAATGGTCCGATTGAACTAAATGATGATGATTTACCATTCTGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  ssbA Bacillus subtilis subsp. subtilis str. 168

55.932

100

0.635

  ssb Latilactobacillus sakei subsp. sakei 23K

51.176

100

0.558

  ssbB Bacillus subtilis subsp. subtilis str. 168

59.434

67.949

0.404

  ssb Neisseria meningitidis MC58

33.526

100

0.372

  ssb Neisseria gonorrhoeae MS11

33.526

100

0.372

  ssb Glaesserella parasuis strain SC1401

32.768

100

0.372

  ssb Vibrio cholerae strain A1552

31.492

100

0.365