Detailed information
Bioinformatically predicted
Overview
| Name | prx | Type | Regulator |
| Locus tag | IUJ46_RS05565 | Genome accession | NZ_CP064364 |
| Coordinates | 1077305..1077487 (-) | Length | 60 a.a. |
| NCBI ID | WP_011184907.1 | Uniprot ID | - |
| Organism | Streptococcus pyogenes strain PartK-Spyogenes-RM8376 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1077305..1118518 | 1077305..1077487 | within | 0 |
Gene organization within MGE regions
Location: 1077305..1118518
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| IUJ46_RS05565 (IUJ46_05540) | prx | 1077305..1077487 (-) | 183 | WP_011184907.1 | hypothetical protein | Regulator |
| IUJ46_RS05570 (IUJ46_05545) | sda3 | 1077725..1078525 (+) | 801 | WP_011285611.1 | streptodornase Sda3 | - |
| IUJ46_RS05575 (IUJ46_05550) | - | 1078798..1079232 (+) | 435 | WP_011017966.1 | hypothetical protein | - |
| IUJ46_RS05580 | - | 1079282..1079692 (-) | 411 | WP_228549912.1 | hypothetical protein | - |
| IUJ46_RS05585 | - | 1079840..1080148 (-) | 309 | WP_228549913.1 | hypothetical protein | - |
| IUJ46_RS05590 (IUJ46_05560) | - | 1080136..1080660 (-) | 525 | WP_011017840.1 | type II toxin-antitoxin system antitoxin SocA domain-containing protein | - |
| IUJ46_RS05595 (IUJ46_05565) | - | 1080800..1082005 (-) | 1206 | WP_011888700.1 | glucosaminidase domain-containing protein | - |
| IUJ46_RS09845 | - | 1081993..1082115 (-) | 123 | WP_029713948.1 | hypothetical protein | - |
| IUJ46_RS05600 (IUJ46_05570) | - | 1082117..1082572 (-) | 456 | WP_011184730.1 | phage holin family protein | - |
| IUJ46_RS05605 (IUJ46_05575) | - | 1082582..1083214 (-) | 633 | WP_011888699.1 | hypothetical protein | - |
| IUJ46_RS05610 (IUJ46_05580) | - | 1083217..1083648 (-) | 432 | WP_002983467.1 | DUF1617 family protein | - |
| IUJ46_RS05615 (IUJ46_05585) | - | 1083660..1085546 (-) | 1887 | WP_014635603.1 | gp58-like family protein | - |
| IUJ46_RS05620 (IUJ46_05590) | - | 1085559..1086569 (-) | 1011 | WP_011017589.1 | hyaluronoglucosaminidase | - |
| IUJ46_RS05625 (IUJ46_05595) | - | 1086566..1088710 (-) | 2145 | WP_014635605.1 | phage tail spike protein | - |
| IUJ46_RS05630 (IUJ46_05600) | - | 1088707..1089423 (-) | 717 | WP_011888697.1 | distal tail protein Dit | - |
| IUJ46_RS05635 (IUJ46_05605) | - | 1089420..1092680 (-) | 3261 | WP_029714384.1 | tape measure protein | - |
| IUJ46_RS05640 (IUJ46_05610) | - | 1092670..1093251 (-) | 582 | WP_011888696.1 | bacteriophage Gp15 family protein | - |
| IUJ46_RS05645 (IUJ46_05615) | - | 1093255..1093689 (-) | 435 | WP_011888695.1 | hypothetical protein | - |
| IUJ46_RS05650 (IUJ46_05620) | - | 1093733..1094194 (-) | 462 | WP_011018120.1 | hypothetical protein | - |
| IUJ46_RS05655 (IUJ46_05625) | - | 1094194..1094592 (-) | 399 | WP_011888694.1 | minor capsid protein | - |
| IUJ46_RS05660 (IUJ46_05630) | - | 1094589..1094945 (-) | 357 | WP_010922083.1 | minor capsid protein | - |
| IUJ46_RS05665 (IUJ46_05635) | - | 1094945..1095277 (-) | 333 | WP_011888693.1 | minor capsid protein | - |
| IUJ46_RS05670 (IUJ46_05640) | - | 1095267..1095683 (-) | 417 | WP_011888692.1 | hypothetical protein | - |
| IUJ46_RS05675 (IUJ46_05645) | - | 1095737..1096555 (-) | 819 | WP_010922080.1 | N4-gp56 family major capsid protein | - |
| IUJ46_RS05680 (IUJ46_05650) | - | 1096559..1097173 (-) | 615 | WP_011888690.1 | hypothetical protein | - |
| IUJ46_RS05685 (IUJ46_05655) | - | 1097299..1097565 (-) | 267 | WP_011888689.1 | hypothetical protein | - |
| IUJ46_RS05690 (IUJ46_05660) | - | 1097652..1097879 (-) | 228 | WP_010922077.1 | hypothetical protein | - |
| IUJ46_RS05695 (IUJ46_05665) | - | 1097879..1099372 (-) | 1494 | WP_029714379.1 | phage minor capsid protein | - |
| IUJ46_RS05700 (IUJ46_05670) | - | 1099377..1100879 (-) | 1503 | WP_010922075.1 | phage portal protein | - |
| IUJ46_RS05705 (IUJ46_05675) | - | 1100893..1102104 (-) | 1212 | WP_010922074.1 | PBSX family phage terminase large subunit | - |
| IUJ46_RS05710 (IUJ46_05680) | - | 1102187..1102663 (-) | 477 | WP_010922073.1 | hypothetical protein | - |
| IUJ46_RS05715 (IUJ46_05685) | - | 1103006..1104172 (-) | 1167 | Protein_1146 | DNA modification methylase | - |
| IUJ46_RS05720 (IUJ46_05690) | - | 1104806..1105240 (-) | 435 | WP_011888687.1 | ArpU family phage packaging/lysis transcriptional regulator | - |
| IUJ46_RS05725 (IUJ46_05695) | - | 1105524..1105694 (-) | 171 | WP_002987493.1 | hypothetical protein | - |
| IUJ46_RS05730 (IUJ46_05700) | - | 1105691..1106170 (-) | 480 | WP_011888686.1 | DUF1642 domain-containing protein | - |
| IUJ46_RS05735 (IUJ46_05705) | - | 1106175..1106807 (-) | 633 | WP_011888685.1 | N-6 DNA methylase | - |
| IUJ46_RS05740 (IUJ46_05710) | - | 1106809..1107093 (-) | 285 | WP_011018134.1 | hypothetical protein | - |
| IUJ46_RS05745 (IUJ46_05715) | - | 1107090..1107260 (-) | 171 | WP_002995952.1 | hypothetical protein | - |
| IUJ46_RS05750 (IUJ46_05720) | - | 1107257..1107493 (-) | 237 | WP_002995955.1 | DUF3310 domain-containing protein | - |
| IUJ46_RS09875 | - | 1107493..1107738 (-) | 246 | WP_011285573.1 | hypothetical protein | - |
| IUJ46_RS05755 (IUJ46_05725) | - | 1107735..1108091 (-) | 357 | WP_011284873.1 | hypothetical protein | - |
| IUJ46_RS05760 (IUJ46_05730) | - | 1108088..1108528 (-) | 441 | WP_011285574.1 | RusA family crossover junction endodeoxyribonuclease | - |
| IUJ46_RS05765 (IUJ46_05735) | - | 1108528..1108731 (-) | 204 | WP_011106686.1 | hypothetical protein | - |
| IUJ46_RS05770 (IUJ46_05740) | ssb | 1108737..1109162 (-) | 426 | WP_011285575.1 | single-stranded DNA-binding protein | Machinery gene |
| IUJ46_RS05775 (IUJ46_05745) | - | 1109155..1109829 (-) | 675 | WP_029714396.1 | ERF family protein | - |
| IUJ46_RS05780 (IUJ46_05750) | - | 1109830..1110312 (-) | 483 | WP_011018142.1 | siphovirus Gp157 family protein | - |
| IUJ46_RS05785 (IUJ46_05755) | - | 1110334..1110588 (-) | 255 | WP_011018143.1 | hypothetical protein | - |
| IUJ46_RS05790 (IUJ46_05760) | - | 1110569..1110922 (-) | 354 | WP_011285579.1 | hypothetical protein | - |
| IUJ46_RS05795 (IUJ46_05765) | - | 1111063..1111845 (-) | 783 | WP_011888684.1 | ATP-binding protein | - |
| IUJ46_RS05800 (IUJ46_05770) | - | 1111832..1112593 (-) | 762 | WP_014635613.1 | DnaD domain protein | - |
| IUJ46_RS05805 (IUJ46_05775) | - | 1112687..1112824 (-) | 138 | WP_011017881.1 | hypothetical protein | - |
| IUJ46_RS05810 (IUJ46_05780) | - | 1112855..1113106 (-) | 252 | WP_011888682.1 | hypothetical protein | - |
| IUJ46_RS05815 (IUJ46_05785) | - | 1113177..1113362 (-) | 186 | WP_011054585.1 | helix-turn-helix transcriptional regulator | - |
| IUJ46_RS05820 (IUJ46_05790) | - | 1113529..1113768 (+) | 240 | WP_011284879.1 | hypothetical protein | - |
| IUJ46_RS05825 (IUJ46_05795) | - | 1113866..1114585 (-) | 720 | WP_011888681.1 | phage antirepressor KilAC domain-containing protein | - |
| IUJ46_RS05830 (IUJ46_05800) | - | 1114613..1114825 (-) | 213 | WP_014635614.1 | DNA-binding protein | - |
| IUJ46_RS05835 (IUJ46_05805) | - | 1115023..1115364 (+) | 342 | WP_011888679.1 | helix-turn-helix transcriptional regulator | - |
| IUJ46_RS05840 (IUJ46_05810) | - | 1115348..1115734 (+) | 387 | WP_023605207.1 | ImmA/IrrE family metallo-endopeptidase | - |
| IUJ46_RS05845 (IUJ46_05815) | - | 1115749..1117170 (+) | 1422 | WP_014635616.1 | DUF4041 domain-containing protein | - |
| IUJ46_RS05850 (IUJ46_05820) | - | 1117352..1118518 (+) | 1167 | WP_011018152.1 | site-specific integrase | - |
Sequence
Protein
Download Length: 60 a.a. Molecular weight: 6976.99 Da Isoelectric Point: 4.2550
>NTDB_id=501074 IUJ46_RS05565 WP_011184907.1 1077305..1077487(-) (prx) [Streptococcus pyogenes strain PartK-Spyogenes-RM8376]
MLTYDEFKQAIDRGYITGDTVMIVRKNGQIFDYVLPHEKVKNGEVVTEEIVEEVMVELDK
MLTYDEFKQAIDRGYITGDTVMIVRKNGQIFDYVLPHEKVKNGEVVTEEIVEEVMVELDK
Nucleotide
Download Length: 183 bp
>NTDB_id=501074 IUJ46_RS05565 WP_011184907.1 1077305..1077487(-) (prx) [Streptococcus pyogenes strain PartK-Spyogenes-RM8376]
ATGCTAACATACGACGAGTTTAAACAAGCGATTGACCGTGGATATATCACAGGAGACACAGTTATGATCGTGCGTAAAAA
CGGACAGATTTTTGATTATGTTTTGCCACATGAGAAAGTAAAAAATGGAGAAGTTGTGACCGAGGAGATAGTGGAAGAAG
TGATGGTGGAATTAGACAAATAA
ATGCTAACATACGACGAGTTTAAACAAGCGATTGACCGTGGATATATCACAGGAGACACAGTTATGATCGTGCGTAAAAA
CGGACAGATTTTTGATTATGTTTTGCCACATGAGAAAGTAAAAAATGGAGAAGTTGTGACCGAGGAGATAGTGGAAGAAG
TGATGGTGGAATTAGACAAATAA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS315 |
85 |
100 |
0.85 |
| prx | Streptococcus pyogenes MGAS8232 |
85 |
100 |
0.85 |
| prx | Streptococcus pyogenes MGAS315 |
85 |
100 |
0.85 |
| prx | Streptococcus pyogenes MGAS315 |
83.333 |
100 |
0.833 |
| prx | Streptococcus pyogenes MGAS315 |
80 |
100 |
0.8 |
| prx | Streptococcus pyogenes MGAS315 |
88.372 |
71.667 |
0.633 |
| prx | Streptococcus pyogenes MGAS315 |
78.571 |
70 |
0.55 |