Detailed information
Overview
| Name | prx | Type | Regulator |
| Locus tag | IUJ46_RS04840 | Genome accession | NZ_CP064364 |
| Coordinates | 940013..940195 (-) | Length | 60 a.a. |
| NCBI ID | WP_029714291.1 | Uniprot ID | - |
| Organism | Streptococcus pyogenes strain PartK-Spyogenes-RM8376 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 940013..974955 | 940013..940195 | within | 0 |
Gene organization within MGE regions
Location: 940013..974955
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| IUJ46_RS04840 (IUJ46_04820) | prx | 940013..940195 (-) | 183 | WP_029714291.1 | hypothetical protein | Regulator |
| IUJ46_RS04845 (IUJ46_04825) | sda3 | 940424..941224 (+) | 801 | WP_011285611.1 | streptodornase Sda3 | - |
| IUJ46_RS04850 (IUJ46_04830) | - | 941495..941929 (+) | 435 | WP_011017966.1 | hypothetical protein | - |
| IUJ46_RS04855 (IUJ46_04835) | - | 941999..943204 (-) | 1206 | WP_010922446.1 | glucosaminidase domain-containing protein | - |
| IUJ46_RS04860 (IUJ46_04840) | - | 943320..943547 (-) | 228 | WP_003058873.1 | phage holin | - |
| IUJ46_RS04865 (IUJ46_04845) | - | 943544..943819 (-) | 276 | WP_002987582.1 | hypothetical protein | - |
| IUJ46_RS04870 (IUJ46_04850) | - | 943829..944446 (-) | 618 | WP_010922447.1 | DUF1366 domain-containing protein | - |
| IUJ46_RS04875 (IUJ46_04855) | - | 944449..944880 (-) | 432 | WP_010922448.1 | DUF1617 family protein | - |
| IUJ46_RS04880 (IUJ46_04860) | - | 944892..946676 (-) | 1785 | WP_010922449.1 | gp58-like family protein | - |
| IUJ46_RS04885 (IUJ46_04865) | - | 946691..947692 (-) | 1002 | WP_023079488.1 | hyaluronidase HylP | - |
| IUJ46_RS04890 (IUJ46_04870) | - | 947692..949650 (-) | 1959 | WP_010922451.1 | phage tail spike protein | - |
| IUJ46_RS04895 (IUJ46_04875) | - | 949647..950342 (-) | 696 | WP_010922452.1 | hypothetical protein | - |
| IUJ46_RS04900 (IUJ46_04880) | - | 950339..952696 (-) | 2358 | WP_010922453.1 | hypothetical protein | - |
| IUJ46_RS04905 (IUJ46_04885) | - | 952696..953067 (-) | 372 | WP_010922454.1 | DUF5361 domain-containing protein | - |
| IUJ46_RS04910 (IUJ46_04890) | - | 953082..953345 (-) | 264 | WP_010922455.1 | hypothetical protein | - |
| IUJ46_RS04915 (IUJ46_04895) | - | 953356..953949 (-) | 594 | WP_010922456.1 | tail protein | - |
| IUJ46_RS04920 (IUJ46_04900) | - | 953961..954296 (-) | 336 | WP_000573598.1 | hypothetical protein | - |
| IUJ46_RS04925 (IUJ46_04905) | - | 954297..954533 (-) | 237 | WP_010922457.1 | hypothetical protein | - |
| IUJ46_RS04930 (IUJ46_04910) | - | 954526..954864 (-) | 339 | WP_011285617.1 | hypothetical protein | - |
| IUJ46_RS04935 (IUJ46_04915) | - | 954824..955246 (-) | 423 | WP_010922459.1 | phage Gp19/Gp15/Gp42 family protein | - |
| IUJ46_RS04940 (IUJ46_04920) | - | 955256..955456 (-) | 201 | WP_010922460.1 | hypothetical protein | - |
| IUJ46_RS04945 (IUJ46_04925) | - | 955456..956367 (-) | 912 | WP_010922461.1 | phage major capsid protein | - |
| IUJ46_RS04950 (IUJ46_04930) | - | 956392..956853 (-) | 462 | WP_010922462.1 | DUF4355 domain-containing protein | - |
| IUJ46_RS04955 (IUJ46_04935) | - | 956934..958349 (-) | 1416 | WP_011285619.1 | terminase | - |
| IUJ46_RS04960 (IUJ46_04940) | - | 958459..958725 (-) | 267 | WP_010922464.1 | hypothetical protein | - |
| IUJ46_RS04965 (IUJ46_04945) | - | 958718..958897 (-) | 180 | WP_015055972.1 | hypothetical protein | - |
| IUJ46_RS04970 (IUJ46_04950) | - | 958947..959171 (-) | 225 | WP_010922466.1 | hypothetical protein | - |
| IUJ46_RS04975 (IUJ46_04955) | - | 959177..960670 (-) | 1494 | WP_010922467.1 | hypothetical protein | - |
| IUJ46_RS04980 (IUJ46_04960) | - | 960663..961931 (-) | 1269 | WP_010922468.1 | phage portal protein | - |
| IUJ46_RS04985 (IUJ46_04965) | - | 961928..962284 (-) | 357 | WP_002994106.1 | hypothetical protein | - |
| IUJ46_RS04990 (IUJ46_04970) | - | 962433..962777 (-) | 345 | WP_010922469.1 | HNH endonuclease signature motif containing protein | - |
| IUJ46_RS04995 (IUJ46_04975) | - | 962886..963305 (-) | 420 | WP_010922470.1 | DUF1492 domain-containing protein | - |
| IUJ46_RS05000 (IUJ46_04980) | - | 963573..964208 (-) | 636 | WP_010922070.1 | N-6 DNA methylase | - |
| IUJ46_RS05005 (IUJ46_04985) | - | 964210..964479 (-) | 270 | WP_002988369.1 | hypothetical protein | - |
| IUJ46_RS05010 (IUJ46_04990) | - | 964563..965075 (-) | 513 | WP_002988366.1 | hypothetical protein | - |
| IUJ46_RS05015 (IUJ46_04995) | - | 965072..965413 (-) | 342 | WP_020837403.1 | hypothetical protein | - |
| IUJ46_RS05020 (IUJ46_05000) | - | 965591..965758 (-) | 168 | WP_011285624.1 | hypothetical protein | - |
| IUJ46_RS05025 (IUJ46_05005) | - | 965768..966565 (-) | 798 | WP_011285625.1 | PD-(D/E)XK nuclease-like domain-containing protein | - |
| IUJ46_RS05030 (IUJ46_05010) | - | 966562..967491 (-) | 930 | WP_011285626.1 | recombinase RecT | - |
| IUJ46_RS05035 (IUJ46_05015) | - | 967494..967823 (-) | 330 | WP_002988359.1 | hypothetical protein | - |
| IUJ46_RS05040 (IUJ46_05020) | - | 967879..968085 (-) | 207 | WP_011017565.1 | hypothetical protein | - |
| IUJ46_RS05045 (IUJ46_05025) | - | 968094..968234 (-) | 141 | WP_011017992.1 | hypothetical protein | - |
| IUJ46_RS05050 (IUJ46_05030) | - | 968231..968464 (-) | 234 | WP_002985387.1 | hypothetical protein | - |
| IUJ46_RS05055 (IUJ46_05035) | - | 968445..968831 (-) | 387 | WP_011017564.1 | DnaD domain-containing protein | - |
| IUJ46_RS05060 | - | 968972..969226 (-) | 255 | WP_011528797.1 | replication protein | - |
| IUJ46_RS05065 (IUJ46_05040) | - | 969335..969520 (-) | 186 | WP_010922477.1 | hypothetical protein | - |
| IUJ46_RS05070 (IUJ46_05045) | - | 969522..969833 (-) | 312 | WP_010922478.1 | excisionase | - |
| IUJ46_RS05075 (IUJ46_05050) | - | 970103..970315 (-) | 213 | WP_010922479.1 | helix-turn-helix transcriptional regulator | - |
| IUJ46_RS05080 (IUJ46_05055) | - | 970516..971271 (+) | 756 | WP_010922480.1 | XRE family transcriptional regulator | - |
| IUJ46_RS05085 (IUJ46_05060) | - | 971283..971801 (+) | 519 | WP_010922481.1 | HIRAN domain-containing protein | - |
| IUJ46_RS05090 (IUJ46_05065) | - | 971925..973067 (+) | 1143 | WP_003051793.1 | site-specific integrase | - |
| IUJ46_RS05095 (IUJ46_05070) | - | 973156..973431 (-) | 276 | WP_002983920.1 | HU family DNA-binding protein | - |
| IUJ46_RS05100 (IUJ46_05075) | - | 973530..974117 (-) | 588 | WP_010922482.1 | YpmS family protein | - |
| IUJ46_RS05105 (IUJ46_05080) | - | 974095..974937 (-) | 843 | WP_002992620.1 | SGNH/GDSL hydrolase family protein | - |
Sequence
Protein
Download Length: 60 a.a. Molecular weight: 6974.02 Da Isoelectric Point: 4.7361
>NTDB_id=501071 IUJ46_RS04840 WP_029714291.1 940013..940195(-) (prx) [Streptococcus pyogenes strain PartK-Spyogenes-RM8376]
MLTYDEFKQAIDRGYITGDTVMIVRKDGQIFDYVLPHEKVKNGEVVTKEKVEEVLVELSR
MLTYDEFKQAIDRGYITGDTVMIVRKDGQIFDYVLPHEKVKNGEVVTKEKVEEVLVELSR
Nucleotide
Download Length: 183 bp
>NTDB_id=501071 IUJ46_RS04840 WP_029714291.1 940013..940195(-) (prx) [Streptococcus pyogenes strain PartK-Spyogenes-RM8376]
ATGCTAACATACGACGAGTTTAAACAAGCGATTGACCGTGGATATATCACAGGAGACACAGTTATGATCGTGCGTAAAGA
CGGACAGATTTTTGATTATGTGTTGCCACATGAGAAAGTAAAGAATGGAGAAGTTGTGACTAAGGAAAAAGTGGAAGAGG
TGCTGGTGGAGCTTTCGAGATAA
ATGCTAACATACGACGAGTTTAAACAAGCGATTGACCGTGGATATATCACAGGAGACACAGTTATGATCGTGCGTAAAGA
CGGACAGATTTTTGATTATGTGTTGCCACATGAGAAAGTAAAGAATGGAGAAGTTGTGACTAAGGAAAAAGTGGAAGAGG
TGCTGGTGGAGCTTTCGAGATAA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS8232 |
95 |
100 |
0.95 |
| prx | Streptococcus pyogenes MGAS315 |
90 |
100 |
0.9 |
| prx | Streptococcus pyogenes MGAS315 |
80 |
100 |
0.8 |
| prx | Streptococcus pyogenes MGAS315 |
71.667 |
100 |
0.717 |
| prx | Streptococcus pyogenes MGAS315 |
86.047 |
71.667 |
0.617 |
| prx | Streptococcus pyogenes MGAS315 |
85.366 |
68.333 |
0.583 |
| prx | Streptococcus pyogenes MGAS315 |
76.19 |
70 |
0.533 |