Detailed information
Bioinformatically predicted
Overview
| Name | prx | Type | Regulator |
| Locus tag | SPYALAB49_RS06320 | Genome accession | NC_017596 |
| Coordinates | 1257167..1257349 (-) | Length | 60 a.a. |
| NCBI ID | WP_011184907.1 | Uniprot ID | - |
| Organism | Streptococcus pyogenes Alab49 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1257167..1298379 | 1257167..1257349 | within | 0 |
Gene organization within MGE regions
Location: 1257167..1298379
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| SPYALAB49_RS06320 (SPYALAB49_001298) | prx | 1257167..1257349 (-) | 183 | WP_011184907.1 | hypothetical protein | Regulator |
| SPYALAB49_RS06325 (SPYALAB49_001299) | sda3 | 1257587..1258387 (+) | 801 | WP_011285611.1 | streptodornase Sda3 | - |
| SPYALAB49_RS06330 (SPYALAB49_001300) | - | 1258659..1259093 (+) | 435 | WP_011017966.1 | hypothetical protein | - |
| SPYALAB49_RS06335 (SPYALAB49_001301) | - | 1259143..1260009 (-) | 867 | WP_014635602.1 | DUF334 domain-containing protein | - |
| SPYALAB49_RS06340 (SPYALAB49_001302) | - | 1259997..1260521 (-) | 525 | WP_011017840.1 | Panacea domain-containing protein | - |
| SPYALAB49_RS06345 (SPYALAB49_001303) | - | 1260661..1261866 (-) | 1206 | WP_011888700.1 | glucosaminidase domain-containing protein | - |
| SPYALAB49_RS10065 | - | 1261854..1261976 (-) | 123 | WP_029713948.1 | hypothetical protein | - |
| SPYALAB49_RS06355 (SPYALAB49_001304) | - | 1261978..1262433 (-) | 456 | WP_011184730.1 | phage holin family protein | - |
| SPYALAB49_RS06360 (SPYALAB49_001305) | - | 1262443..1263075 (-) | 633 | WP_011888699.1 | hypothetical protein | - |
| SPYALAB49_RS06365 (SPYALAB49_001306) | - | 1263078..1263509 (-) | 432 | WP_002983467.1 | DUF1617 family protein | - |
| SPYALAB49_RS06370 (SPYALAB49_001307) | - | 1263521..1265407 (-) | 1887 | WP_014635603.1 | gp58-like family protein | - |
| SPYALAB49_RS06375 (SPYALAB49_001308) | - | 1265420..1266430 (-) | 1011 | WP_011017589.1 | hyaluronoglucosaminidase | - |
| SPYALAB49_RS06380 (SPYALAB49_001309) | - | 1266427..1268571 (-) | 2145 | WP_014635605.1 | phage tail spike protein | - |
| SPYALAB49_RS06385 (SPYALAB49_001310) | - | 1268568..1269284 (-) | 717 | WP_011888697.1 | distal tail protein Dit | - |
| SPYALAB49_RS06390 (SPYALAB49_001311) | - | 1269281..1272541 (-) | 3261 | WP_014635606.1 | tape measure protein | - |
| SPYALAB49_RS06395 (SPYALAB49_001312) | - | 1272531..1273112 (-) | 582 | WP_011888696.1 | bacteriophage Gp15 family protein | - |
| SPYALAB49_RS06400 (SPYALAB49_001313) | - | 1273116..1273550 (-) | 435 | WP_011888695.1 | hypothetical protein | - |
| SPYALAB49_RS06405 (SPYALAB49_001314) | - | 1273594..1274055 (-) | 462 | WP_011018120.1 | phage tail tube protein | - |
| SPYALAB49_RS06410 (SPYALAB49_001315) | - | 1274055..1274453 (-) | 399 | WP_011888694.1 | minor capsid protein | - |
| SPYALAB49_RS06415 (SPYALAB49_001316) | - | 1274450..1274806 (-) | 357 | WP_010922083.1 | minor capsid protein | - |
| SPYALAB49_RS06420 (SPYALAB49_001317) | - | 1274806..1275138 (-) | 333 | WP_011888693.1 | minor capsid protein | - |
| SPYALAB49_RS06425 (SPYALAB49_001318) | - | 1275128..1275544 (-) | 417 | WP_011888692.1 | hypothetical protein | - |
| SPYALAB49_RS06430 (SPYALAB49_001319) | - | 1275598..1276416 (-) | 819 | WP_010922080.1 | N4-gp56 family major capsid protein | - |
| SPYALAB49_RS06435 (SPYALAB49_001320) | - | 1276420..1277034 (-) | 615 | WP_011888690.1 | hypothetical protein | - |
| SPYALAB49_RS06440 (SPYALAB49_001321) | - | 1277160..1277426 (-) | 267 | WP_011888689.1 | hypothetical protein | - |
| SPYALAB49_RS06445 (SPYALAB49_001322) | - | 1277513..1277740 (-) | 228 | WP_010922077.1 | hypothetical protein | - |
| SPYALAB49_RS06450 (SPYALAB49_001323) | - | 1277740..1279233 (-) | 1494 | WP_014635607.1 | phage minor capsid protein | - |
| SPYALAB49_RS06455 (SPYALAB49_001324) | - | 1279238..1280740 (-) | 1503 | WP_010922075.1 | phage portal protein | - |
| SPYALAB49_RS06460 (SPYALAB49_001325) | - | 1280754..1282045 (-) | 1292 | Protein_1240 | PBSX family phage terminase large subunit | - |
| SPYALAB49_RS06465 (SPYALAB49_001326) | - | 1282048..1282524 (-) | 477 | WP_010922073.1 | hypothetical protein | - |
| SPYALAB49_RS06470 (SPYALAB49_001327) | - | 1282867..1284033 (-) | 1167 | Protein_1242 | DNA modification methylase | - |
| SPYALAB49_RS06475 (SPYALAB49_001329) | - | 1284667..1285101 (-) | 435 | WP_011888687.1 | ArpU family phage packaging/lysis transcriptional regulator | - |
| SPYALAB49_RS09810 | - | 1285385..1285555 (-) | 171 | WP_002987493.1 | hypothetical protein | - |
| SPYALAB49_RS06480 (SPYALAB49_001330) | - | 1285552..1286031 (-) | 480 | WP_011888686.1 | DUF1642 domain-containing protein | - |
| SPYALAB49_RS06485 (SPYALAB49_001331) | - | 1286036..1286668 (-) | 633 | WP_014635608.1 | N-6 DNA methylase | - |
| SPYALAB49_RS06490 | - | 1286670..1286954 (-) | 285 | WP_011284869.1 | hypothetical protein | - |
| SPYALAB49_RS09815 (SPYALAB49_001332) | - | 1286951..1287121 (-) | 171 | WP_002995952.1 | hypothetical protein | - |
| SPYALAB49_RS06495 (SPYALAB49_001333) | - | 1287118..1287354 (-) | 237 | WP_002995955.1 | DUF3310 domain-containing protein | - |
| SPYALAB49_RS10090 | - | 1287354..1287599 (-) | 246 | WP_011285573.1 | hypothetical protein | - |
| SPYALAB49_RS06505 | - | 1287596..1287952 (-) | 357 | WP_041174291.1 | hypothetical protein | - |
| SPYALAB49_RS06510 (SPYALAB49_001335) | - | 1287949..1288389 (-) | 441 | WP_011285574.1 | RusA family crossover junction endodeoxyribonuclease | - |
| SPYALAB49_RS06515 | - | 1288389..1288592 (-) | 204 | WP_011106686.1 | hypothetical protein | - |
| SPYALAB49_RS06520 (SPYALAB49_001336) | ssb | 1288598..1289023 (-) | 426 | WP_011285575.1 | single-stranded DNA-binding protein | Machinery gene |
| SPYALAB49_RS06525 (SPYALAB49_001337) | - | 1289016..1289690 (-) | 675 | WP_014635611.1 | ERF family protein | - |
| SPYALAB49_RS06530 (SPYALAB49_001338) | - | 1289691..1290173 (-) | 483 | WP_011018142.1 | siphovirus Gp157 family protein | - |
| SPYALAB49_RS06535 (SPYALAB49_001339) | - | 1290195..1290449 (-) | 255 | WP_011018143.1 | hypothetical protein | - |
| SPYALAB49_RS06540 (SPYALAB49_001340) | - | 1290430..1290720 (-) | 291 | WP_014635612.1 | hypothetical protein | - |
| SPYALAB49_RS06545 (SPYALAB49_001342) | - | 1290924..1291706 (-) | 783 | WP_011888684.1 | ATP-binding protein | - |
| SPYALAB49_RS06550 (SPYALAB49_001343) | - | 1291693..1292454 (-) | 762 | WP_014635613.1 | DnaD domain protein | - |
| SPYALAB49_RS09820 (SPYALAB49_001344) | - | 1292548..1292685 (-) | 138 | WP_011017881.1 | hypothetical protein | - |
| SPYALAB49_RS06555 (SPYALAB49_001345) | - | 1292716..1292967 (-) | 252 | WP_011888682.1 | AlpA family transcriptional regulator | - |
| SPYALAB49_RS06560 (SPYALAB49_001346) | - | 1293038..1293223 (-) | 186 | WP_011054585.1 | helix-turn-helix transcriptional regulator | - |
| SPYALAB49_RS06565 (SPYALAB49_001347) | - | 1293390..1293629 (+) | 240 | WP_011284879.1 | hypothetical protein | - |
| SPYALAB49_RS06570 (SPYALAB49_001348) | - | 1293727..1294446 (-) | 720 | WP_011888681.1 | phage antirepressor KilAC domain-containing protein | - |
| SPYALAB49_RS06575 (SPYALAB49_001349) | - | 1294474..1294686 (-) | 213 | WP_014635614.1 | DNA-binding protein | - |
| SPYALAB49_RS06580 (SPYALAB49_001350) | - | 1294884..1295225 (+) | 342 | WP_011888679.1 | helix-turn-helix transcriptional regulator | - |
| SPYALAB49_RS06585 (SPYALAB49_001351) | - | 1295209..1295595 (+) | 387 | WP_023605207.1 | ImmA/IrrE family metallo-endopeptidase | - |
| SPYALAB49_RS06590 (SPYALAB49_001352) | - | 1295610..1297031 (+) | 1422 | WP_014635616.1 | DUF4041 domain-containing protein | - |
| SPYALAB49_RS06595 (SPYALAB49_001353) | - | 1297213..1298379 (+) | 1167 | WP_011018152.1 | site-specific integrase | - |
Sequence
Protein
Download Length: 60 a.a. Molecular weight: 6976.99 Da Isoelectric Point: 4.2550
>NTDB_id=49543 SPYALAB49_RS06320 WP_011184907.1 1257167..1257349(-) (prx) [Streptococcus pyogenes Alab49]
MLTYDEFKQAIDRGYITGDTVMIVRKNGQIFDYVLPHEKVKNGEVVTEEIVEEVMVELDK
MLTYDEFKQAIDRGYITGDTVMIVRKNGQIFDYVLPHEKVKNGEVVTEEIVEEVMVELDK
Nucleotide
Download Length: 183 bp
>NTDB_id=49543 SPYALAB49_RS06320 WP_011184907.1 1257167..1257349(-) (prx) [Streptococcus pyogenes Alab49]
ATGCTAACATACGACGAGTTTAAACAAGCGATTGACCGTGGATATATCACAGGAGACACAGTTATGATCGTGCGTAAAAA
CGGACAGATTTTTGATTATGTTTTGCCACATGAGAAAGTAAAAAATGGAGAAGTTGTGACCGAGGAGATAGTGGAAGAAG
TGATGGTGGAATTAGACAAATAA
ATGCTAACATACGACGAGTTTAAACAAGCGATTGACCGTGGATATATCACAGGAGACACAGTTATGATCGTGCGTAAAAA
CGGACAGATTTTTGATTATGTTTTGCCACATGAGAAAGTAAAAAATGGAGAAGTTGTGACCGAGGAGATAGTGGAAGAAG
TGATGGTGGAATTAGACAAATAA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS315 |
85 |
100 |
0.85 |
| prx | Streptococcus pyogenes MGAS8232 |
85 |
100 |
0.85 |
| prx | Streptococcus pyogenes MGAS315 |
85 |
100 |
0.85 |
| prx | Streptococcus pyogenes MGAS315 |
83.333 |
100 |
0.833 |
| prx | Streptococcus pyogenes MGAS315 |
80 |
100 |
0.8 |
| prx | Streptococcus pyogenes MGAS315 |
88.372 |
71.667 |
0.633 |
| prx | Streptococcus pyogenes MGAS315 |
78.571 |
70 |
0.55 |