Detailed information
Overview
| Name | prx | Type | Regulator |
| Locus tag | SPYALAB49_RS05685 | Genome accession | NC_017596 |
| Coordinates | 1131589..1131771 (-) | Length | 60 a.a. |
| NCBI ID | WP_014635572.1 | Uniprot ID | A0A8B6J386 |
| Organism | Streptococcus pyogenes Alab49 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1131589..1157879 | 1131589..1131771 | within | 0 |
Gene organization within MGE regions
Location: 1131589..1157879
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| SPYALAB49_RS05685 (SPYALAB49_001167) | prx | 1131589..1131771 (-) | 183 | WP_014635572.1 | hypothetical protein | Regulator |
| SPYALAB49_RS05690 (SPYALAB49_001168) | mf2 | 1132011..1132769 (+) | 759 | WP_014635573.1 | DNase Mf2 | - |
| SPYALAB49_RS05695 (SPYALAB49_001169) | speC | 1132880..1133587 (+) | 708 | WP_002985327.1 | streptococcal pyrogenic exotoxin SpeC | - |
| SPYALAB49_RS05700 (SPYALAB49_001170) | - | 1133656..1134873 (-) | 1218 | WP_014635574.1 | peptidoglycan amidohydrolase family protein | - |
| SPYALAB49_RS05710 (SPYALAB49_001171) | - | 1134992..1135219 (-) | 228 | WP_003058873.1 | phage holin | - |
| SPYALAB49_RS05715 (SPYALAB49_001172) | - | 1135216..1135488 (-) | 273 | WP_011017397.1 | hypothetical protein | - |
| SPYALAB49_RS05720 (SPYALAB49_001173) | - | 1135500..1136132 (-) | 633 | WP_014635575.1 | hypothetical protein | - |
| SPYALAB49_RS05725 (SPYALAB49_001174) | - | 1136135..1136563 (-) | 429 | WP_011528780.1 | DUF1617 family protein | - |
| SPYALAB49_RS05730 (SPYALAB49_001175) | - | 1136572..1138353 (-) | 1782 | WP_011528781.1 | gp58-like family protein | - |
| SPYALAB49_RS05735 (SPYALAB49_001176) | hylP | 1138368..1139483 (-) | 1116 | WP_011528782.1 | hyaluronoglucosaminidase | - |
| SPYALAB49_RS05740 (SPYALAB49_001177) | - | 1139480..1141456 (-) | 1977 | WP_028797149.1 | phage tail spike protein | - |
| SPYALAB49_RS05745 (SPYALAB49_001178) | - | 1141438..1142133 (-) | 696 | WP_002992579.1 | hypothetical protein | - |
| SPYALAB49_RS05750 (SPYALAB49_001179) | - | 1142130..1144487 (-) | 2358 | WP_011528784.1 | hypothetical protein | - |
| SPYALAB49_RS05755 (SPYALAB49_001180) | - | 1144487..1144858 (-) | 372 | WP_011528785.1 | DUF5361 domain-containing protein | - |
| SPYALAB49_RS05760 (SPYALAB49_001181) | - | 1144873..1145136 (-) | 264 | WP_003047548.1 | hypothetical protein | - |
| SPYALAB49_RS05765 (SPYALAB49_001182) | - | 1145147..1145725 (-) | 579 | WP_014635577.1 | hypothetical protein | - |
| SPYALAB49_RS05770 (SPYALAB49_001183) | - | 1145737..1146072 (-) | 336 | WP_011528787.1 | hypothetical protein | - |
| SPYALAB49_RS05775 (SPYALAB49_001184) | - | 1146317..1146568 (-) | 252 | WP_011054692.1 | hypothetical protein | - |
| SPYALAB49_RS09800 (SPYALAB49_001185) | - | 1146565..1146720 (-) | 156 | WP_011054693.1 | hypothetical protein | - |
| SPYALAB49_RS05780 (SPYALAB49_001186) | - | 1146717..1147034 (-) | 318 | WP_011054694.1 | DUF1372 family protein | - |
| SPYALAB49_RS05785 (SPYALAB49_001187) | - | 1147070..1147582 (-) | 513 | WP_011054695.1 | hypothetical protein | - |
| SPYALAB49_RS05790 (SPYALAB49_001188) | - | 1147579..1147911 (-) | 333 | WP_011184741.1 | hypothetical protein | - |
| SPYALAB49_RS05795 (SPYALAB49_001189) | - | 1147922..1149268 (-) | 1347 | WP_011054697.1 | PcfJ domain-containing protein | - |
| SPYALAB49_RS05800 (SPYALAB49_001190) | - | 1149265..1149660 (-) | 396 | WP_011054698.1 | Cas9 inhibitor AcrIIA9 family protein | - |
| SPYALAB49_RS05805 (SPYALAB49_001191) | - | 1150025..1150822 (-) | 798 | WP_011054699.1 | PD-(D/E)XK nuclease-like domain-containing protein | - |
| SPYALAB49_RS05810 (SPYALAB49_001192) | - | 1150815..1151015 (-) | 201 | WP_000594115.1 | hypothetical protein | - |
| SPYALAB49_RS05815 (SPYALAB49_001193) | - | 1151012..1151938 (-) | 927 | WP_011054700.1 | recombinase RecT | - |
| SPYALAB49_RS05820 (SPYALAB49_001194) | - | 1151941..1152270 (-) | 330 | WP_011528796.1 | hypothetical protein | - |
| SPYALAB49_RS05825 (SPYALAB49_001195) | - | 1152326..1152532 (-) | 207 | WP_002988357.1 | hypothetical protein | - |
| SPYALAB49_RS09805 (SPYALAB49_001196) | - | 1152541..1152681 (-) | 141 | WP_002988354.1 | hypothetical protein | - |
| SPYALAB49_RS05830 (SPYALAB49_001197) | - | 1152678..1152911 (-) | 234 | WP_010922205.1 | hypothetical protein | - |
| SPYALAB49_RS05835 (SPYALAB49_001198) | - | 1152892..1153278 (-) | 387 | WP_011017564.1 | DnaD domain-containing protein | - |
| SPYALAB49_RS09970 | - | 1153419..1153688 (-) | 270 | WP_011106700.1 | replication protein | - |
| SPYALAB49_RS05845 (SPYALAB49_001199) | - | 1153782..1153967 (-) | 186 | WP_010922477.1 | hypothetical protein | - |
| SPYALAB49_RS05850 (SPYALAB49_001200) | - | 1153969..1154280 (-) | 312 | WP_010922478.1 | excisionase | - |
| SPYALAB49_RS05855 (SPYALAB49_001201) | - | 1154550..1154762 (-) | 213 | WP_010922479.1 | helix-turn-helix domain-containing protein | - |
| SPYALAB49_RS05860 (SPYALAB49_001202) | - | 1154964..1155719 (+) | 756 | WP_010922480.1 | XRE family transcriptional regulator | - |
| SPYALAB49_RS05865 (SPYALAB49_001203) | - | 1155731..1156249 (+) | 519 | WP_011528799.1 | HIRAN domain-containing protein | - |
| SPYALAB49_RS05870 (SPYALAB49_001204) | - | 1156373..1157515 (+) | 1143 | WP_003051793.1 | site-specific integrase | - |
| SPYALAB49_RS05875 (SPYALAB49_001205) | - | 1157604..1157879 (-) | 276 | WP_002983920.1 | HU family DNA-binding protein | - |
Sequence
Protein
Download Length: 60 a.a. Molecular weight: 7067.01 Da Isoelectric Point: 4.1079
>NTDB_id=49540 SPYALAB49_RS05685 WP_014635572.1 1131589..1131771(-) (prx) [Streptococcus pyogenes Alab49]
MLTYDEFKQAIDNGYITGDTVMIVRKNGQIFDYVLPNEKIRDWEVVTDEKVEEVLVELSR
MLTYDEFKQAIDNGYITGDTVMIVRKNGQIFDYVLPNEKIRDWEVVTDEKVEEVLVELSR
Nucleotide
Download Length: 183 bp
>NTDB_id=49540 SPYALAB49_RS05685 WP_014635572.1 1131589..1131771(-) (prx) [Streptococcus pyogenes Alab49]
ATGCTAACATACGACGAATTTAAGCAAGCAATTGACAACGGATATATCACAGGAGACACAGTTATGATCGTGCGTAAAAA
CGGACAGATTTTTGATTATGTTTTGCCGAATGAGAAGATAAGAGATTGGGAGGTTGTGACAGACGAAAAAGTGGAAGAGG
TGCTGGTGGAGCTTTCGAGATAA
ATGCTAACATACGACGAATTTAAGCAAGCAATTGACAACGGATATATCACAGGAGACACAGTTATGATCGTGCGTAAAAA
CGGACAGATTTTTGATTATGTTTTGCCGAATGAGAAGATAAGAGATTGGGAGGTTGTGACAGACGAAAAAGTGGAAGAGG
TGCTGGTGGAGCTTTCGAGATAA
Domains
No domain identified.
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS315 |
90 |
100 |
0.9 |
| prx | Streptococcus pyogenes MGAS8232 |
85 |
100 |
0.85 |
| prx | Streptococcus pyogenes MGAS315 |
80 |
100 |
0.8 |
| prx | Streptococcus pyogenes MGAS315 |
73.333 |
100 |
0.733 |
| prx | Streptococcus pyogenes MGAS315 |
90.244 |
68.333 |
0.617 |
| prx | Streptococcus pyogenes MGAS315 |
85.714 |
70 |
0.6 |
| prx | Streptococcus pyogenes MGAS315 |
78.571 |
70 |
0.55 |