Detailed information
Bioinformatically predicted
Overview
| Name | prx | Type | Regulator |
| Locus tag | SPYALAB49_RS04840 | Genome accession | NC_017596 |
| Coordinates | 967200..967388 (-) | Length | 62 a.a. |
| NCBI ID | WP_011054546.1 | Uniprot ID | A0A5S4TJS4 |
| Organism | Streptococcus pyogenes Alab49 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 959612..1013333 | 967200..967388 | within | 0 |
Gene organization within MGE regions
Location: 959612..1013333
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| SPYALAB49_RS04810 (SPYALAB49_000977) | pfkA | 959612..960625 (-) | 1014 | WP_002984444.1 | 6-phosphofructokinase | - |
| SPYALAB49_RS04815 (SPYALAB49_000978) | - | 960705..963815 (-) | 3111 | WP_002984441.1 | DNA polymerase III subunit alpha | - |
| SPYALAB49_RS04820 (SPYALAB49_000979) | - | 964000..964371 (+) | 372 | WP_002989617.1 | GntR family transcriptional regulator | - |
| SPYALAB49_RS04825 (SPYALAB49_000980) | - | 964371..965069 (+) | 699 | WP_002992425.1 | ABC transporter ATP-binding protein | - |
| SPYALAB49_RS04830 (SPYALAB49_000981) | - | 965079..965864 (+) | 786 | WP_002984433.1 | hypothetical protein | - |
| SPYALAB49_RS04835 (SPYALAB49_000982) | - | 965995..966609 (-) | 615 | WP_002989607.1 | TVP38/TMEM64 family protein | - |
| SPYALAB49_RS04840 (SPYALAB49_000983) | prx | 967200..967388 (-) | 189 | WP_011054546.1 | hypothetical protein | Regulator |
| SPYALAB49_RS04845 (SPYALAB49_000984) | spel | 967503..968291 (-) | 789 | WP_014635496.1 | streptococcal pyrogenic exotoxin SpeL | - |
| SPYALAB49_RS04850 (SPYALAB49_000985) | spem | 968573..969286 (-) | 714 | WP_014635497.1 | streptococcal pyrogenic exotoxin SpeM | - |
| SPYALAB49_RS04855 (SPYALAB49_000986) | - | 969590..970456 (-) | 867 | WP_014635498.1 | DUF334 domain-containing protein | - |
| SPYALAB49_RS04860 (SPYALAB49_000987) | - | 970444..970968 (-) | 525 | WP_011017840.1 | Panacea domain-containing protein | - |
| SPYALAB49_RS04865 (SPYALAB49_000988) | - | 971108..971749 (-) | 642 | Protein_918 | CHAP domain-containing protein | - |
| SPYALAB49_RS04870 (SPYALAB49_000989) | - | 971862..972554 (-) | 693 | WP_002994484.1 | AP2 domain-containing protein | - |
| SPYALAB49_RS04875 (SPYALAB49_000990) | - | 972790..973344 (-) | 555 | Protein_920 | glycoside hydrolase family 73 protein | - |
| SPYALAB49_RS04885 (SPYALAB49_000991) | - | 973456..973911 (-) | 456 | WP_002988455.1 | phage holin family protein | - |
| SPYALAB49_RS04890 (SPYALAB49_000992) | - | 973927..974532 (-) | 606 | WP_011184581.1 | DUF1366 domain-containing protein | - |
| SPYALAB49_RS04895 (SPYALAB49_000993) | - | 974535..974963 (-) | 429 | WP_011184582.1 | DUF1617 family protein | - |
| SPYALAB49_RS04900 (SPYALAB49_000994) | - | 974975..976861 (-) | 1887 | WP_014635500.1 | gp58-like family protein | - |
| SPYALAB49_RS04905 (SPYALAB49_000995) | hylP | 976876..977892 (-) | 1017 | WP_014635501.1 | hyaluronidase HylP | - |
| SPYALAB49_RS04910 (SPYALAB49_000996) | - | 977892..979940 (-) | 2049 | WP_014635502.1 | phage tail spike protein | - |
| SPYALAB49_RS04915 (SPYALAB49_000997) | - | 979937..980716 (-) | 780 | WP_014635503.1 | distal tail protein Dit | - |
| SPYALAB49_RS04920 (SPYALAB49_000998) | - | 980748..984383 (-) | 3636 | WP_014635504.1 | tape measure protein | - |
| SPYALAB49_RS04925 (SPYALAB49_000999) | - | 984398..984727 (-) | 330 | WP_002988428.1 | hypothetical protein | - |
| SPYALAB49_RS04930 (SPYALAB49_001000) | - | 984769..985122 (-) | 354 | WP_002990023.1 | tail assembly chaperone | - |
| SPYALAB49_RS04935 (SPYALAB49_001001) | - | 985175..985783 (-) | 609 | WP_038432972.1 | phage major tail protein, TP901-1 family | - |
| SPYALAB49_RS04940 (SPYALAB49_001002) | - | 985838..986227 (-) | 390 | WP_014635506.1 | hypothetical protein | - |
| SPYALAB49_RS04945 (SPYALAB49_001003) | - | 986224..986589 (-) | 366 | WP_038432514.1 | HK97-gp10 family putative phage morphogenesis protein | - |
| SPYALAB49_RS04950 | - | 986570..986878 (-) | 309 | WP_002984393.1 | hypothetical protein | - |
| SPYALAB49_RS04955 (SPYALAB49_001005) | - | 986875..987228 (-) | 354 | WP_002984392.1 | phage head-tail connector protein | - |
| SPYALAB49_RS04960 (SPYALAB49_001006) | - | 987242..987484 (-) | 243 | WP_002984390.1 | HeH/LEM domain-containing protein | - |
| SPYALAB49_RS04965 (SPYALAB49_001007) | - | 987494..988570 (-) | 1077 | WP_014635509.1 | major capsid protein | - |
| SPYALAB49_RS04970 (SPYALAB49_001008) | - | 988570..988950 (-) | 381 | WP_014635510.1 | hypothetical protein | - |
| SPYALAB49_RS04975 (SPYALAB49_001009) | - | 988960..989493 (-) | 534 | WP_014635511.1 | DUF4355 domain-containing protein | - |
| SPYALAB49_RS04980 (SPYALAB49_001010) | - | 989605..990351 (-) | 747 | WP_010922216.1 | phage antirepressor KilAC domain-containing protein | - |
| SPYALAB49_RS04985 (SPYALAB49_001011) | - | 990353..990601 (-) | 249 | WP_014635512.1 | hypothetical protein | - |
| SPYALAB49_RS09340 (SPYALAB49_001012) | - | 990730..990894 (-) | 165 | WP_162467708.1 | hypothetical protein | - |
| SPYALAB49_RS04990 (SPYALAB49_001013) | - | 990990..991260 (-) | 271 | Protein_943 | hypothetical protein | - |
| SPYALAB49_RS04995 (SPYALAB49_001014) | - | 991319..991498 (-) | 180 | WP_010922213.1 | hypothetical protein | - |
| SPYALAB49_RS05000 (SPYALAB49_001015) | - | 991489..993114 (-) | 1626 | WP_014635514.1 | phage head morphogenesis protein | - |
| SPYALAB49_RS05005 (SPYALAB49_001016) | - | 993095..994597 (-) | 1503 | WP_002984369.1 | phage portal protein | - |
| SPYALAB49_RS05010 (SPYALAB49_001017) | - | 994609..995916 (-) | 1308 | WP_014635515.1 | PBSX family phage terminase large subunit | - |
| SPYALAB49_RS05015 (SPYALAB49_001018) | - | 995894..996346 (-) | 453 | WP_032461951.1 | terminase small subunit | - |
| SPYALAB49_RS05020 (SPYALAB49_001019) | - | 996436..996852 (-) | 417 | WP_014635517.1 | transcriptional regulator | - |
| SPYALAB49_RS05025 (SPYALAB49_001020) | - | 996849..997565 (-) | 717 | WP_014635518.1 | DUF1642 domain-containing protein | - |
| SPYALAB49_RS05030 (SPYALAB49_001021) | - | 997562..997855 (-) | 294 | WP_011888761.1 | hypothetical protein | - |
| SPYALAB49_RS05035 (SPYALAB49_001022) | - | 997852..998037 (-) | 186 | WP_011184603.1 | hypothetical protein | - |
| SPYALAB49_RS05040 (SPYALAB49_001023) | - | 998181..998465 (-) | 285 | WP_014635520.1 | VRR-NUC domain-containing protein | - |
| SPYALAB49_RS05045 (SPYALAB49_001024) | - | 998485..999354 (-) | 870 | WP_014635521.1 | bifunctional DNA primase/polymerase | - |
| SPYALAB49_RS05050 (SPYALAB49_001025) | - | 999623..1001176 (-) | 1554 | WP_011017876.1 | hypothetical protein | - |
| SPYALAB49_RS05055 (SPYALAB49_001026) | - | 1001194..1001676 (-) | 483 | WP_014635522.1 | DUF669 domain-containing protein | - |
| SPYALAB49_RS05060 (SPYALAB49_001027) | - | 1001681..1003105 (-) | 1425 | Protein_957 | DEAD/DEAH box helicase | - |
| SPYALAB49_RS05065 (SPYALAB49_001028) | - | 1003120..1003803 (-) | 684 | WP_014635524.1 | AAA family ATPase | - |
| SPYALAB49_RS05070 (SPYALAB49_001029) | - | 1003800..1004084 (-) | 285 | WP_011284877.1 | hypothetical protein | - |
| SPYALAB49_RS05075 (SPYALAB49_001030) | - | 1004081..1004275 (-) | 195 | WP_002984315.1 | hypothetical protein | - |
| SPYALAB49_RS05080 (SPYALAB49_001031) | - | 1004275..1004604 (-) | 330 | WP_011284878.1 | hypothetical protein | - |
| SPYALAB49_RS09775 (SPYALAB49_001033) | - | 1004685..1004822 (-) | 138 | WP_011017881.1 | hypothetical protein | - |
| SPYALAB49_RS05085 (SPYALAB49_001034) | - | 1004819..1005115 (-) | 297 | WP_011017882.1 | MerR family transcriptional regulator | - |
| SPYALAB49_RS05090 (SPYALAB49_001035) | - | 1005194..1005379 (-) | 186 | WP_011054585.1 | helix-turn-helix transcriptional regulator | - |
| SPYALAB49_RS05095 (SPYALAB49_001036) | - | 1005546..1005785 (+) | 240 | WP_011284879.1 | hypothetical protein | - |
| SPYALAB49_RS05100 (SPYALAB49_001037) | - | 1005935..1006144 (+) | 210 | WP_002984292.1 | hypothetical protein | - |
| SPYALAB49_RS05110 (SPYALAB49_001039) | - | 1006403..1006912 (+) | 510 | WP_014635526.1 | hypothetical protein | - |
| SPYALAB49_RS05115 (SPYALAB49_001040) | - | 1007043..1007252 (+) | 210 | WP_011017885.1 | hypothetical protein | - |
| SPYALAB49_RS05120 (SPYALAB49_001041) | - | 1007362..1007562 (-) | 201 | WP_002992770.1 | helix-turn-helix domain-containing protein | - |
| SPYALAB49_RS05125 (SPYALAB49_001042) | - | 1007656..1008327 (+) | 672 | WP_014635527.1 | DUF4145 domain-containing protein | - |
| SPYALAB49_RS10055 (SPYALAB49_001043) | - | 1008284..1008409 (-) | 126 | WP_014635528.1 | hypothetical protein | - |
| SPYALAB49_RS09780 (SPYALAB49_001044) | - | 1008444..1008602 (-) | 159 | WP_014635529.1 | hypothetical protein | - |
| SPYALAB49_RS05130 (SPYALAB49_001045) | - | 1008661..1008876 (+) | 216 | WP_014635530.1 | hypothetical protein | - |
| SPYALAB49_RS09785 (SPYALAB49_001046) | - | 1008862..1009011 (-) | 150 | WP_014635531.1 | hypothetical protein | - |
| SPYALAB49_RS05135 (SPYALAB49_001047) | - | 1009366..1010190 (+) | 825 | WP_023080030.1 | helix-turn-helix transcriptional regulator | - |
| SPYALAB49_RS05140 (SPYALAB49_001048) | - | 1010203..1011012 (+) | 810 | WP_002984270.1 | type II toxin-antitoxin system PemK/MazF family toxin | - |
| SPYALAB49_RS05145 (SPYALAB49_001050) | - | 1011262..1012350 (+) | 1089 | WP_014635533.1 | site-specific integrase | - |
| SPYALAB49_RS05150 (SPYALAB49_001051) | - | 1012713..1013333 (+) | 621 | WP_002989605.1 | DUF3862 domain-containing protein | - |
Sequence
Protein
Download Length: 62 a.a. Molecular weight: 7226.17 Da Isoelectric Point: 3.9947
>NTDB_id=49537 SPYALAB49_RS04840 WP_011054546.1 967200..967388(-) (prx) [Streptococcus pyogenes Alab49]
MLTYDEFKQAIDDGYIVGDTVMIVRKNGQIFDYVLPHEEARNGEVVTEEKVEEVMVELDYIK
MLTYDEFKQAIDDGYIVGDTVMIVRKNGQIFDYVLPHEEARNGEVVTEEKVEEVMVELDYIK
Nucleotide
Download Length: 189 bp
>NTDB_id=49537 SPYALAB49_RS04840 WP_011054546.1 967200..967388(-) (prx) [Streptococcus pyogenes Alab49]
ATGCTAACATACGACGAATTTAAGCAAGCTATTGATGACGGATATATCGTAGGAGACACAGTTATGATCGTGCGTAAAAA
CGGACAGATTTTTGATTATGTGTTGCCGCATGAGGAAGCGAGAAATGGAGAAGTTGTGACAGAGGAGAAGGTGGAAGAAG
TGATGGTGGAATTAGACTATATCAAATGA
ATGCTAACATACGACGAATTTAAGCAAGCTATTGATGACGGATATATCGTAGGAGACACAGTTATGATCGTGCGTAAAAA
CGGACAGATTTTTGATTATGTGTTGCCGCATGAGGAAGCGAGAAATGGAGAAGTTGTGACAGAGGAGAAGGTGGAAGAAG
TGATGGTGGAATTAGACTATATCAAATGA
Domains
No domain identified.
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS315 |
100 |
100 |
1 |
| prx | Streptococcus pyogenes MGAS315 |
84.746 |
95.161 |
0.806 |
| prx | Streptococcus pyogenes MGAS8232 |
84.483 |
93.548 |
0.79 |
| prx | Streptococcus pyogenes MGAS315 |
82.759 |
93.548 |
0.774 |
| prx | Streptococcus pyogenes MGAS315 |
77.966 |
95.161 |
0.742 |
| prx | Streptococcus pyogenes MGAS315 |
87.805 |
66.129 |
0.581 |
| prx | Streptococcus pyogenes MGAS315 |
76.19 |
67.742 |
0.516 |