Detailed information
Bioinformatically predicted
Overview
| Name | ssbA | Type | Machinery gene |
| Locus tag | ILP76_RS04765 | Genome accession | NZ_CP062469 |
| Coordinates | 986752..987222 (+) | Length | 156 a.a. |
| NCBI ID | WP_000934762.1 | Uniprot ID | - |
| Organism | Staphylococcus aureus strain MRSA - AMRF 4 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 973158..1018230 | 986752..987222 | within | 0 |
Gene organization within MGE regions
Location: 973158..1018230
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ILP76_RS04655 (ILP76_04655) | lukH | 973158..974210 (+) | 1053 | WP_000791415.1 | bi-component leukocidin LukGH subunit H | - |
| ILP76_RS04660 (ILP76_04660) | lukG | 974232..975248 (+) | 1017 | WP_000595401.1 | bi-component leukocidin LukGH subunit G | - |
| ILP76_RS04665 (ILP76_04665) | sph | 975486..976310 (-) | 825 | Protein_922 | sphingomyelin phosphodiesterase | - |
| ILP76_RS04670 (ILP76_04670) | - | 976367..977404 (-) | 1038 | WP_000857176.1 | tyrosine-type recombinase/integrase | - |
| ILP76_RS04675 (ILP76_04675) | - | 977512..978126 (+) | 615 | WP_000191459.1 | hypothetical protein | - |
| ILP76_RS04680 (ILP76_04680) | - | 978123..978269 (-) | 147 | WP_001013104.1 | hypothetical protein | - |
| ILP76_RS04685 (ILP76_04685) | - | 978305..978487 (-) | 183 | WP_000705240.1 | hypothetical protein | - |
| ILP76_RS04690 (ILP76_04690) | - | 978687..979406 (-) | 720 | WP_000358221.1 | XRE family transcriptional regulator | - |
| ILP76_RS04695 (ILP76_04695) | - | 979548..979766 (+) | 219 | WP_001198673.1 | helix-turn-helix transcriptional regulator | - |
| ILP76_RS04700 (ILP76_04700) | - | 979781..980089 (+) | 309 | WP_001153965.1 | hypothetical protein | - |
| ILP76_RS04705 (ILP76_04705) | - | 980246..980998 (+) | 753 | WP_001148641.1 | phage antirepressor KilAC domain-containing protein | - |
| ILP76_RS04710 (ILP76_04710) | - | 981014..981208 (+) | 195 | WP_001148852.1 | hypothetical protein | - |
| ILP76_RS04715 (ILP76_04715) | - | 981203..981559 (-) | 357 | WP_000768245.1 | DUF2513 domain-containing protein | - |
| ILP76_RS04720 (ILP76_04720) | - | 981609..981800 (+) | 192 | WP_000389906.1 | hypothetical protein | - |
| ILP76_RS04725 (ILP76_04725) | - | 981802..982029 (-) | 228 | WP_000801108.1 | hypothetical protein | - |
| ILP76_RS04730 (ILP76_04730) | - | 982088..982408 (+) | 321 | WP_001120935.1 | DUF771 domain-containing protein | - |
| ILP76_RS04735 (ILP76_04735) | - | 982405..982566 (+) | 162 | WP_000066020.1 | DUF1270 domain-containing protein | - |
| ILP76_RS04740 (ILP76_04740) | - | 982659..982919 (+) | 261 | WP_000291489.1 | DUF1108 family protein | - |
| ILP76_RS04745 (ILP76_04745) | - | 982928..983191 (+) | 264 | WP_001205732.1 | hypothetical protein | - |
| ILP76_RS04750 (ILP76_04750) | - | 983188..985131 (+) | 1944 | WP_194085675.1 | AAA family ATPase | - |
| ILP76_RS04755 (ILP76_04755) | - | 985133..986053 (+) | 921 | WP_000138475.1 | recombinase RecT | - |
| ILP76_RS04760 (ILP76_04760) | - | 986134..986751 (+) | 618 | WP_072353921.1 | MBL fold metallo-hydrolase | - |
| ILP76_RS04765 (ILP76_04765) | ssbA | 986752..987222 (+) | 471 | WP_000934762.1 | single-stranded DNA-binding protein | Machinery gene |
| ILP76_RS04770 (ILP76_04770) | - | 987252..988145 (+) | 894 | WP_194085676.1 | DnaD domain protein | - |
| ILP76_RS04775 (ILP76_04775) | - | 988152..988370 (+) | 219 | WP_000338527.1 | hypothetical protein | - |
| ILP76_RS04780 (ILP76_04780) | - | 988379..988834 (+) | 456 | WP_000401965.1 | RusA family crossover junction endodeoxyribonuclease | - |
| ILP76_RS04785 (ILP76_04785) | - | 988847..989215 (+) | 369 | WP_000101270.1 | SA1788 family PVL leukocidin-associated protein | - |
| ILP76_RS04790 (ILP76_04790) | - | 989219..989461 (+) | 243 | WP_000131381.1 | phi PVL orf 51-like protein | - |
| ILP76_RS04795 (ILP76_04795) | - | 989476..989727 (+) | 252 | WP_001065046.1 | DUF1024 family protein | - |
| ILP76_RS04800 (ILP76_04800) | - | 989717..989890 (+) | 174 | WP_000028424.1 | hypothetical protein | - |
| ILP76_RS04805 (ILP76_04805) | - | 989919..990173 (+) | 255 | WP_223289771.1 | hypothetical protein | - |
| ILP76_RS04810 (ILP76_04810) | - | 990174..990335 (+) | 162 | WP_000889682.1 | hypothetical protein | - |
| ILP76_RS04815 (ILP76_04815) | - | 990350..990883 (+) | 534 | WP_001061838.1 | dUTPase | - |
| ILP76_RS04820 (ILP76_04820) | - | 990920..991165 (+) | 246 | WP_001282074.1 | hypothetical protein | - |
| ILP76_RS04825 (ILP76_04825) | - | 991162..991368 (+) | 207 | WP_000195803.1 | DUF1381 domain-containing protein | - |
| ILP76_RS04830 (ILP76_04830) | - | 991365..991751 (+) | 387 | WP_000592201.1 | hypothetical protein | - |
| ILP76_RS04835 (ILP76_04835) | rinB | 991748..991897 (+) | 150 | WP_000595305.1 | transcriptional activator RinB | - |
| ILP76_RS04840 (ILP76_04840) | - | 992056..992706 (+) | 651 | WP_001005262.1 | hypothetical protein | - |
| ILP76_RS04845 (ILP76_04845) | - | 992706..992906 (+) | 201 | WP_000265041.1 | DUF1514 family protein | - |
| ILP76_RS04850 (ILP76_04850) | - | 992929..993390 (+) | 462 | WP_072495574.1 | hypothetical protein | - |
| ILP76_RS04855 (ILP76_04855) | - | 993505..993957 (+) | 453 | WP_000406191.1 | nucleoside triphosphate pyrophosphohydrolase family protein | - |
| ILP76_RS04860 (ILP76_04860) | - | 993973..994317 (+) | 345 | WP_000817289.1 | HNH endonuclease | - |
| ILP76_RS04865 (ILP76_04865) | - | 994445..994912 (+) | 468 | WP_000919026.1 | phage terminase small subunit P27 family | - |
| ILP76_RS04870 (ILP76_04870) | - | 994915..996609 (+) | 1695 | WP_194085677.1 | terminase large subunit | - |
| ILP76_RS04875 (ILP76_04875) | - | 996623..996823 (+) | 201 | WP_000365301.1 | hypothetical protein | - |
| ILP76_RS04880 (ILP76_04880) | - | 996829..998079 (+) | 1251 | WP_000511064.1 | phage portal protein | - |
| ILP76_RS04885 (ILP76_04885) | - | 998072..998656 (+) | 585 | WP_000032523.1 | HK97 family phage prohead protease | - |
| ILP76_RS04890 (ILP76_04890) | - | 998744..999991 (+) | 1248 | WP_000849958.1 | phage major capsid protein | - |
| ILP76_RS04895 (ILP76_04895) | - | 1000027..1000185 (+) | 159 | WP_001252099.1 | hypothetical protein | - |
| ILP76_RS04900 (ILP76_04900) | - | 1000194..1000526 (+) | 333 | WP_001177489.1 | head-tail connector protein | - |
| ILP76_RS04905 (ILP76_04905) | - | 1000513..1000848 (+) | 336 | WP_000975314.1 | head-tail adaptor protein | - |
| ILP76_RS04910 (ILP76_04910) | - | 1000848..1001225 (+) | 378 | WP_000501244.1 | HK97-gp10 family putative phage morphogenesis protein | - |
| ILP76_RS04915 (ILP76_04915) | - | 1001222..1001602 (+) | 381 | WP_000611449.1 | hypothetical protein | - |
| ILP76_RS04920 (ILP76_04920) | - | 1001603..1002556 (+) | 954 | WP_000570652.1 | major tail protein | - |
| ILP76_RS04925 (ILP76_04925) | gpG | 1002621..1003067 (+) | 447 | WP_000442601.1 | phage tail assembly chaperone G | - |
| ILP76_RS04930 (ILP76_04930) | gpGT | 1003127..1003249 (+) | 123 | WP_000571956.1 | phage tail assembly chaperone GT | - |
| ILP76_RS04935 (ILP76_04935) | - | 1003305..1007954 (+) | 4650 | Protein_976 | phage tail tape measure protein | - |
| ILP76_RS04940 (ILP76_04940) | - | 1007954..1009444 (+) | 1491 | WP_001154317.1 | phage distal tail protein | - |
| ILP76_RS04945 (ILP76_04945) | - | 1009460..1013241 (+) | 3782 | Protein_978 | phage tail spike protein | - |
| ILP76_RS04950 (ILP76_04950) | - | 1013234..1013386 (+) | 153 | WP_001000058.1 | hypothetical protein | - |
| ILP76_RS04955 (ILP76_04955) | - | 1013432..1013719 (+) | 288 | WP_001262620.1 | hypothetical protein | - |
| ILP76_RS04960 (ILP76_04960) | - | 1013775..1014149 (+) | 375 | WP_000340977.1 | hypothetical protein | - |
| ILP76_RS04965 (ILP76_04965) | pepG1 | 1014334..1014468 (+) | 135 | WP_000880502.1 | type I toxin-antitoxin system toxin PepG1 | - |
| ILP76_RS04970 (ILP76_04970) | - | 1014521..1014628 (-) | 108 | WP_001791821.1 | hypothetical protein | - |
| ILP76_RS04975 (ILP76_04975) | - | 1014680..1014934 (+) | 255 | WP_000611512.1 | phage holin | - |
| ILP76_RS04980 (ILP76_04980) | - | 1014946..1015701 (+) | 756 | WP_000861038.1 | CHAP domain-containing protein | - |
| ILP76_RS04985 (ILP76_04985) | sak | 1015892..1016383 (+) | 492 | WP_000920038.1 | staphylokinase | - |
| ILP76_RS04990 (ILP76_04990) | - | 1017031..1017369 (+) | 339 | Protein_987 | SH3 domain-containing protein | - |
| ILP76_RS04995 (ILP76_04995) | scn | 1017880..1018230 (+) | 351 | WP_000702263.1 | complement inhibitor SCIN-A | - |
Sequence
Protein
Download Length: 156 a.a. Molecular weight: 17673.58 Da Isoelectric Point: 5.2670
>NTDB_id=490277 ILP76_RS04765 WP_000934762.1 986752..987222(+) (ssbA) [Staphylococcus aureus strain MRSA - AMRF 4]
MLNRTILVGRLTRDPELRTTQSGVNVASFTLAVNRTFTNAQGEREADFINIIVFKKQAENVNKYLSKGSLAGVDGRLQTR
NYENKEGQRVYVTEVVADSIQFLEPKNSNDTQQDLYQQQVQQTRGQSQYSNNKPVKDNPFANANCPIEIDDNDLPF
MLNRTILVGRLTRDPELRTTQSGVNVASFTLAVNRTFTNAQGEREADFINIIVFKKQAENVNKYLSKGSLAGVDGRLQTR
NYENKEGQRVYVTEVVADSIQFLEPKNSNDTQQDLYQQQVQQTRGQSQYSNNKPVKDNPFANANCPIEIDDNDLPF
Nucleotide
Download Length: 471 bp
>NTDB_id=490277 ILP76_RS04765 WP_000934762.1 986752..987222(+) (ssbA) [Staphylococcus aureus strain MRSA - AMRF 4]
ATGCTAAACAGAACAATATTAGTTGGTCGTTTAACTAGAGACCCAGAATTAAGAACCACTCAAAGTGGTGTAAATGTAGC
ATCATTCACATTAGCAGTAAACCGCACATTTACGAATGCACAAGGAGAGCGCGAGGCAGACTTTATTAATATCATCGTAT
TTAAAAAACAAGCAGAGAACGTTAATAAATACCTATCTAAAGGATCGTTGGCGGGCGTAGATGGTAGGTTACAAACGCGG
AACTATGAAAATAAGGAAGGTCAACGTGTATACGTTACGGAAGTTGTTGCCGATAGTATTCAATTTTTAGAACCGAAAAA
CTCAAATGACACTCAACAAGATTTATACCAACAACAAGTACAACAAACACGTGGACAATCGCAATATTCAAATAACAAAC
CAGTAAAAGATAATCCGTTTGCGAATGCAAATTGTCCGATTGAAATAGATGACAATGATTTACCATTCTAA
ATGCTAAACAGAACAATATTAGTTGGTCGTTTAACTAGAGACCCAGAATTAAGAACCACTCAAAGTGGTGTAAATGTAGC
ATCATTCACATTAGCAGTAAACCGCACATTTACGAATGCACAAGGAGAGCGCGAGGCAGACTTTATTAATATCATCGTAT
TTAAAAAACAAGCAGAGAACGTTAATAAATACCTATCTAAAGGATCGTTGGCGGGCGTAGATGGTAGGTTACAAACGCGG
AACTATGAAAATAAGGAAGGTCAACGTGTATACGTTACGGAAGTTGTTGCCGATAGTATTCAATTTTTAGAACCGAAAAA
CTCAAATGACACTCAACAAGATTTATACCAACAACAAGTACAACAAACACGTGGACAATCGCAATATTCAAATAACAAAC
CAGTAAAAGATAATCCGTTTGCGAATGCAAATTGTCCGATTGAAATAGATGACAATGATTTACCATTCTAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
55.932 |
100 |
0.635 |
| ssb | Latilactobacillus sakei subsp. sakei 23K |
51.176 |
100 |
0.558 |
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
59.434 |
67.949 |
0.404 |
| ssb | Vibrio cholerae strain A1552 |
31.492 |
100 |
0.365 |
| ssb | Neisseria meningitidis MC58 |
32.948 |
100 |
0.365 |
| ssb | Neisseria gonorrhoeae MS11 |
32.948 |
100 |
0.365 |
| ssb | Glaesserella parasuis strain SC1401 |
32.203 |
100 |
0.365 |