NTDB

Overview

Name	clpP	Type	Regulator
Locus tag	J7886_RS17970	Genome accession	NZ_CP072539
Coordinates	3714749..3715372 (-)	Length	207 a.a.
NCBI ID	WP_000122253.1	Uniprot ID	A0A370V1H3
Organism	Escherichia coli O128ac:H12 strain AW1.7
Function	degradation of ComK; degradation of DegU (predicted from homology) Competence regulation

Genomic Context

Location: 3709749..3720372

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
J7886_RS17955 (J7886_17950)	hupB	3710326..3710616 (-)	291	WP_254892905.1	nucleoid-associated protein HU-beta	-
J7886_RS17960 (J7886_17955)	lon	3710807..3713161 (-)	2355	WP_001295325.1	endopeptidase La	-
J7886_RS17965 (J7886_17960)	clpX	3713349..3714623 (-)	1275	WP_000130305.1	ATP-dependent protease ATP-binding subunit ClpX	Regulator
J7886_RS17970 (J7886_17965)	clpP	3714749..3715372 (-)	624	WP_000122253.1	ATP-dependent Clp endopeptidase proteolytic subunit ClpP	Regulator
J7886_RS17975 (J7886_17970)	tig	3715618..3716916 (-)	1299	WP_001198386.1	trigger factor	-
J7886_RS17980 (J7886_17975)	-	3717063..3717209 (-)	147	WP_000788433.1	hypothetical protein	-
J7886_RS17985 (J7886_17980)	bolA	3717260..3717577 (-)	318	WP_000973448.1	transcriptional regulator BolA	-
J7886_RS17990 (J7886_17985)	yajG	3717882..3718460 (+)	579	WP_001295326.1	lipoprotein	-
J7886_RS17995 (J7886_17990)	ampG	3718504..3719979 (+)	1476	WP_000098438.1	muropeptide MFS transporter AmpG	-

Sequence

Protein

Download Length: 207 a.a. Molecular weight: 23186.65 Da Isoelectric Point: 5.6032

                                >NTDB_id=484037 J7886_RS17970 WP_000122253.1 3714749..3715372(-) (clpP) [Escherichia coli O128ac:H12 strain AW1.7]

MSYSGERDNFAPHMALVPMVIEQTSRGERSFDIYSRLLKERVIFLTGQVEDHMANLIVAQMLFLEAENPEKDIYLYINSP

GGVITAGMSIYDTMQFIKPDVSTICMGQAASMGAFLLTAGAKGKRFCLPNSRVMIHQPLGGYQGQATDIEIHAREILKVK

GRMNELMALHTGQSLEQIERDTERDRFLSAPEAVEYGLVDSILTHRN

Nucleotide

Download Length: 624 bp

                                >NTDB_id=484037 J7886_RS17970 WP_000122253.1 3714749..3715372(-) (clpP) [Escherichia coli O128ac:H12 strain AW1.7]

ATGTCATACAGCGGCGAACGAGATAACTTTGCACCCCATATGGCGCTGGTGCCGATGGTCATTGAACAGACCTCACGCGG

TGAGCGCTCTTTTGATATCTATTCTCGTCTACTTAAGGAACGCGTCATTTTTCTGACTGGCCAGGTTGAAGACCACATGG

CTAACCTGATTGTGGCGCAGATGCTGTTCCTGGAAGCGGAAAACCCAGAAAAAGATATCTATCTGTACATTAACTCCCCA

GGCGGGGTGATCACTGCCGGGATGTCTATCTATGACACCATGCAGTTTATCAAGCCTGATGTCAGCACTATCTGTATGGG

CCAGGCGGCCTCGATGGGCGCTTTCTTGCTGACCGCAGGGGCAAAAGGTAAACGTTTTTGCCTGCCGAATTCGCGCGTGA

TGATTCACCAACCGTTGGGCGGCTACCAGGGCCAGGCGACCGATATCGAAATTCATGCCCGTGAAATTCTGAAAGTTAAA

GGGCGCATGAATGAACTTATGGCGCTTCATACGGGTCAATCATTAGAACAGATTGAACGTGATACCGAGCGCGATCGCTT

CCTTTCCGCCCCTGAAGCGGTGGAATACGGTCTGGTCGATTCGATTCTGACCCATCGTAATTGA

Domains

Predicted by InterProScan.

Clp protease (CLP_protease)

(26-205)

Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.

3D structure

Source	ID	Structure
AlphaFold DB	A0A370V1H3

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.

Visualization of predicted probability:

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	H_a-value
clpP	Bacillus subtilis subsp. subtilis str. 168	69.792	92.754	0.647
clpP	Campylobacter jejuni subsp. jejuni NCTC 11168 = ATCC 700819	68.617	90.821	0.623
clpP	Lactococcus lactis subsp. cremoris KW2	56.701	93.72	0.531
clpP	Streptococcus pneumoniae R6	55.155	93.72	0.517
clpP	Streptococcus pneumoniae TIGR4	55.155	93.72	0.517
clpP	Lactococcus lactis subsp. lactis strain DGCC12653	55.155	93.72	0.517
clpP	Streptococcus pneumoniae Rx1	55.155	93.72	0.517
clpP	Streptococcus pneumoniae D39	55.155	93.72	0.517
clpP	Streptococcus thermophilus LMD-9	54.922	93.237	0.512
clpP	Streptococcus thermophilus LMG 18311	54.922	93.237	0.512
clpP	Streptococcus pyogenes JRS4	55.263	91.787	0.507
clpP	Streptococcus pyogenes MGAS315	55.263	91.787	0.507
clpP	Streptococcus mutans UA159	53.886	93.237	0.502

Detailed information NTG0484037