Detailed information
Bioinformatically predicted
Overview
| Name | prx | Type | Regulator |
| Locus tag | IB935_RS06300 | Genome accession | NZ_CP061134 |
| Coordinates | 1257463..1257645 (-) | Length | 60 a.a. |
| NCBI ID | WP_002986897.1 | Uniprot ID | A0A660A6E2 |
| Organism | Streptococcus pyogenes strain BSAC_bs192 isolate Invasive disease | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1257463..1299503 | 1257463..1257645 | within | 0 |
Gene organization within MGE regions
Location: 1257463..1299503
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| IB935_RS06300 (IB935_06300) | prx | 1257463..1257645 (-) | 183 | WP_002986897.1 | hypothetical protein | Regulator |
| IB935_RS06305 (IB935_06305) | - | 1257991..1258566 (-) | 576 | WP_011054727.1 | hypothetical protein | - |
| IB935_RS06310 (IB935_06310) | spek | 1259042..1259821 (-) | 780 | WP_011054728.1 | streptococcal pyrogenic exotoxin SpeK | - |
| IB935_RS06315 (IB935_06315) | - | 1260126..1260992 (-) | 867 | WP_011054729.1 | DUF334 domain-containing protein | - |
| IB935_RS06320 (IB935_06320) | - | 1260980..1261504 (-) | 525 | WP_011017840.1 | Panacea domain-containing protein | - |
| IB935_RS06325 (IB935_06325) | - | 1261644..1262846 (-) | 1203 | WP_023611747.1 | glucosaminidase domain-containing protein | - |
| IB935_RS06330 (IB935_06330) | - | 1262962..1263189 (-) | 228 | WP_000609113.1 | phage holin | - |
| IB935_RS06335 (IB935_06335) | - | 1263186..1263461 (-) | 276 | WP_002987582.1 | hypothetical protein | - |
| IB935_RS06340 (IB935_06340) | - | 1263471..1264088 (-) | 618 | WP_032461328.1 | DUF1366 domain-containing protein | - |
| IB935_RS06345 (IB935_06345) | - | 1264091..1264522 (-) | 432 | WP_002987513.1 | DUF1617 family protein | - |
| IB935_RS06350 (IB935_06350) | - | 1264534..1266420 (-) | 1887 | WP_136075572.1 | gp58-like family protein | - |
| IB935_RS06355 (IB935_06355) | - | 1266431..1266745 (-) | 315 | WP_063812987.1 | hypothetical protein | - |
| IB935_RS06360 (IB935_06360) | - | 1266747..1267970 (-) | 1224 | WP_030127718.1 | hypothetical protein | - |
| IB935_RS06365 (IB935_06365) | - | 1267967..1270114 (-) | 2148 | WP_187835563.1 | phage tail spike protein | - |
| IB935_RS06370 (IB935_06370) | - | 1270111..1270827 (-) | 717 | WP_187835565.1 | distal tail protein Dit | - |
| IB935_RS06375 (IB935_06375) | - | 1270824..1274084 (-) | 3261 | WP_030126579.1 | tape measure protein | - |
| IB935_RS06380 (IB935_06380) | - | 1274074..1274655 (-) | 582 | WP_136076193.1 | bacteriophage Gp15 family protein | - |
| IB935_RS06385 (IB935_06385) | - | 1274659..1275093 (-) | 435 | WP_011888695.1 | hypothetical protein | - |
| IB935_RS06390 (IB935_06390) | - | 1275137..1275598 (-) | 462 | WP_011018120.1 | phage tail tube protein | - |
| IB935_RS06395 (IB935_06395) | - | 1275598..1275996 (-) | 399 | WP_011888694.1 | minor capsid protein | - |
| IB935_RS06400 (IB935_06400) | - | 1275993..1276349 (-) | 357 | WP_010922083.1 | minor capsid protein | - |
| IB935_RS06405 (IB935_06405) | - | 1276349..1276681 (-) | 333 | WP_010922082.1 | minor capsid protein | - |
| IB935_RS06410 (IB935_06410) | - | 1276671..1277087 (-) | 417 | WP_111706022.1 | hypothetical protein | - |
| IB935_RS06415 (IB935_06415) | - | 1277141..1277959 (-) | 819 | WP_010922080.1 | N4-gp56 family major capsid protein | - |
| IB935_RS06420 (IB935_06420) | - | 1277963..1278577 (-) | 615 | WP_011106689.1 | hypothetical protein | - |
| IB935_RS06425 (IB935_06425) | - | 1278703..1278969 (-) | 267 | WP_011054745.1 | hypothetical protein | - |
| IB935_RS06430 (IB935_06430) | - | 1279031..1279270 (-) | 240 | WP_002986829.1 | hypothetical protein | - |
| IB935_RS06435 (IB935_06435) | - | 1279242..1280720 (-) | 1479 | WP_011054746.1 | phage minor capsid protein | - |
| IB935_RS06440 (IB935_06440) | - | 1280725..1282227 (-) | 1503 | WP_010922075.1 | phage portal protein | - |
| IB935_RS06445 (IB935_06445) | - | 1282241..1283532 (-) | 1292 | Protein_1230 | PBSX family phage terminase large subunit | - |
| IB935_RS06450 (IB935_06450) | - | 1283535..1284011 (-) | 477 | WP_010922073.1 | hypothetical protein | - |
| IB935_RS06455 (IB935_06455) | - | 1284354..1285520 (-) | 1167 | WP_019418850.1 | DNA modification methylase | - |
| IB935_RS06460 (IB935_06460) | - | 1285682..1286119 (-) | 438 | WP_003052405.1 | DUF1492 domain-containing protein | - |
| IB935_RS06465 (IB935_06465) | - | 1286386..1287021 (-) | 636 | WP_010922070.1 | N-6 DNA methylase | - |
| IB935_RS06470 (IB935_06470) | - | 1287023..1287307 (-) | 285 | WP_136075588.1 | hypothetical protein | - |
| IB935_RS06475 (IB935_06475) | - | 1287304..1287717 (-) | 414 | WP_136075587.1 | YopX family protein | - |
| IB935_RS06480 (IB935_06480) | - | 1287727..1287996 (-) | 270 | WP_002987593.1 | hypothetical protein | - |
| IB935_RS06485 (IB935_06485) | - | 1287993..1288277 (-) | 285 | WP_011017568.1 | DUF3310 domain-containing protein | - |
| IB935_RS06490 (IB935_06490) | - | 1288271..1288468 (-) | 198 | WP_011017567.1 | hypothetical protein | - |
| IB935_RS06495 (IB935_06495) | - | 1288455..1288967 (-) | 513 | WP_111695843.1 | hypothetical protein | - |
| IB935_RS06500 (IB935_06500) | - | 1288964..1289302 (-) | 339 | WP_002990067.1 | hypothetical protein | - |
| IB935_RS06505 (IB935_06505) | - | 1289479..1289646 (-) | 168 | WP_009880273.1 | hypothetical protein | - |
| IB935_RS06510 (IB935_06510) | - | 1289656..1290453 (-) | 798 | WP_136022701.1 | PD-(D/E)XK nuclease-like domain-containing protein | - |
| IB935_RS06515 (IB935_06515) | - | 1290446..1290646 (-) | 201 | WP_000594115.1 | hypothetical protein | - |
| IB935_RS06520 (IB935_06520) | - | 1290643..1291569 (-) | 927 | WP_011054700.1 | recombinase RecT | - |
| IB935_RS06525 (IB935_06525) | - | 1291572..1291901 (-) | 330 | WP_011528796.1 | hypothetical protein | - |
| IB935_RS06530 (IB935_06530) | - | 1291957..1292163 (-) | 207 | WP_002988357.1 | hypothetical protein | - |
| IB935_RS06535 (IB935_06535) | - | 1292172..1292312 (-) | 141 | WP_011017992.1 | hypothetical protein | - |
| IB935_RS06540 (IB935_06540) | - | 1292318..1292530 (-) | 213 | WP_002986875.1 | hypothetical protein | - |
| IB935_RS06545 (IB935_06545) | - | 1292511..1292921 (-) | 411 | WP_172450154.1 | DnaD domain-containing protein | - |
| IB935_RS06550 (IB935_06550) | - | 1293043..1293300 (-) | 258 | WP_019418742.1 | hypothetical protein | - |
| IB935_RS06555 (IB935_06555) | - | 1293394..1293579 (-) | 186 | WP_002986881.1 | hypothetical protein | - |
| IB935_RS06560 (IB935_06560) | - | 1293608..1293865 (-) | 258 | WP_032463372.1 | hypothetical protein | - |
| IB935_RS06565 (IB935_06565) | - | 1293971..1294186 (+) | 216 | WP_023611028.1 | hypothetical protein | - |
| IB935_RS06570 (IB935_06570) | - | 1294160..1294408 (-) | 249 | WP_023611035.1 | hypothetical protein | - |
| IB935_RS06575 (IB935_06575) | - | 1294487..1294687 (+) | 201 | WP_002986887.1 | KTSC domain-containing protein | - |
| IB935_RS06580 (IB935_06580) | - | 1294684..1294833 (-) | 150 | WP_002986888.1 | hypothetical protein | - |
| IB935_RS06585 (IB935_06585) | - | 1294866..1295594 (-) | 729 | WP_002986890.1 | phage antirepressor KilAC domain-containing protein | - |
| IB935_RS06590 (IB935_06590) | - | 1295605..1295796 (-) | 192 | WP_002986891.1 | hypothetical protein | - |
| IB935_RS06595 (IB935_06595) | - | 1296431..1296526 (+) | 96 | WP_020837683.1 | type I toxin-antitoxin system Fst family toxin | - |
| IB935_RS06600 (IB935_06600) | - | 1296951..1297304 (+) | 354 | WP_002986893.1 | helix-turn-helix domain-containing protein | - |
| IB935_RS06605 (IB935_06605) | - | 1297318..1297698 (+) | 381 | WP_076634137.1 | ImmA/IrrE family metallo-endopeptidase | - |
| IB935_RS06610 (IB935_06610) | - | 1297709..1298230 (+) | 522 | WP_136075586.1 | hypothetical protein | - |
| IB935_RS06615 (IB935_06615) | - | 1298406..1299503 (+) | 1098 | WP_032463383.1 | site-specific integrase | - |
Sequence
Protein
Download Length: 60 a.a. Molecular weight: 6772.68 Da Isoelectric Point: 3.9286
>NTDB_id=480995 IB935_RS06300 WP_002986897.1 1257463..1257645(-) (prx) [Streptococcus pyogenes strain BSAC_bs192 isolate Invasive disease]
MLTYDEFKQAIDDGYIVGDTVAIVRKNGQIFDYVLPGEKVRPSEVVAEEIVEEVVVELDK
MLTYDEFKQAIDDGYIVGDTVAIVRKNGQIFDYVLPGEKVRPSEVVAEEIVEEVVVELDK
Nucleotide
Download Length: 183 bp
>NTDB_id=480995 IB935_RS06300 WP_002986897.1 1257463..1257645(-) (prx) [Streptococcus pyogenes strain BSAC_bs192 isolate Invasive disease]
ATGCTAACATACGACGAGTTTAAGCAAGCAATCGATGACGGATATATCGTAGGAGACACAGTAGCGATTGTGCGTAAAAA
CGGACAGATTTTTGATTATGTGTTGCCTGGCGAAAAAGTCAGACCGTCGGAGGTTGTGGCTGAGGAAATAGTGGAAGAGG
TGGTGGTGGAATTAGACAAATAA
ATGCTAACATACGACGAGTTTAAGCAAGCAATCGATGACGGATATATCGTAGGAGACACAGTAGCGATTGTGCGTAAAAA
CGGACAGATTTTTGATTATGTGTTGCCTGGCGAAAAAGTCAGACCGTCGGAGGTTGTGGCTGAGGAAATAGTGGAAGAGG
TGGTGGTGGAATTAGACAAATAA
Domains
No domain identified.
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS315 |
98.333 |
100 |
0.983 |
| prx | Streptococcus pyogenes MGAS315 |
81.667 |
100 |
0.817 |
| prx | Streptococcus pyogenes MGAS8232 |
78.333 |
100 |
0.783 |
| prx | Streptococcus pyogenes MGAS315 |
78.333 |
100 |
0.783 |
| prx | Streptococcus pyogenes MGAS315 |
73.333 |
100 |
0.733 |
| prx | Streptococcus pyogenes MGAS315 |
90.244 |
68.333 |
0.617 |
| prx | Streptococcus pyogenes MGAS315 |
82.927 |
68.333 |
0.567 |