Detailed information
Overview
| Name | prx | Type | Regulator |
| Locus tag | IB935_RS05815 | Genome accession | NZ_CP061134 |
| Coordinates | 1172630..1172812 (-) | Length | 60 a.a. |
| NCBI ID | WP_011528776.1 | Uniprot ID | A0A660A5W9 |
| Organism | Streptococcus pyogenes strain BSAC_bs192 isolate Invasive disease | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1172630..1200933 | 1172630..1172812 | within | 0 |
Gene organization within MGE regions
Location: 1172630..1200933
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| IB935_RS05815 (IB935_05815) | prx | 1172630..1172812 (-) | 183 | WP_011528776.1 | hypothetical protein | Regulator |
| IB935_RS05820 (IB935_05820) | entC3 | 1172925..1173707 (-) | 783 | WP_002988472.1 | enterotoxin type C3 EntC3 | - |
| IB935_RS05825 (IB935_05825) | - | 1173955..1175079 (-) | 1125 | WP_002988467.1 | Fic family protein | - |
| IB935_RS05830 (IB935_05830) | - | 1175215..1176432 (-) | 1218 | WP_011528778.1 | peptidoglycan amidohydrolase family protein | - |
| IB935_RS05835 (IB935_05835) | - | 1176551..1176778 (-) | 228 | WP_003058873.1 | phage holin | - |
| IB935_RS05840 (IB935_05840) | - | 1176775..1177047 (-) | 273 | WP_011017397.1 | hypothetical protein | - |
| IB935_RS05845 (IB935_05845) | - | 1177059..1177691 (-) | 633 | WP_011528779.1 | hypothetical protein | - |
| IB935_RS05850 (IB935_05850) | - | 1177694..1178122 (-) | 429 | WP_011528780.1 | DUF1617 family protein | - |
| IB935_RS05855 (IB935_05855) | - | 1178131..1179912 (-) | 1782 | WP_011528781.1 | gp58-like family protein | - |
| IB935_RS05860 (IB935_05860) | hylP | 1179927..1181042 (-) | 1116 | WP_011528782.1 | hyaluronoglucosaminidase | - |
| IB935_RS05865 (IB935_05865) | - | 1181039..1183015 (-) | 1977 | WP_011528783.1 | phage tail spike protein | - |
| IB935_RS05870 (IB935_05870) | - | 1182997..1183692 (-) | 696 | WP_002992579.1 | hypothetical protein | - |
| IB935_RS05875 (IB935_05875) | - | 1183689..1186046 (-) | 2358 | WP_011528784.1 | hypothetical protein | - |
| IB935_RS05880 (IB935_05880) | - | 1186046..1186417 (-) | 372 | WP_011528785.1 | DUF5361 domain-containing protein | - |
| IB935_RS05885 (IB935_05885) | - | 1186432..1186695 (-) | 264 | WP_003047548.1 | hypothetical protein | - |
| IB935_RS05890 (IB935_05890) | - | 1186706..1187284 (-) | 579 | WP_014635577.1 | hypothetical protein | - |
| IB935_RS05900 (IB935_05900) | - | 1187408..1187743 (-) | 336 | WP_011528787.1 | hypothetical protein | - |
| IB935_RS05905 (IB935_05905) | - | 1187744..1187980 (-) | 237 | WP_000032787.1 | hypothetical protein | - |
| IB935_RS05910 (IB935_05910) | - | 1187973..1188310 (-) | 338 | Protein_1123 | hypothetical protein | - |
| IB935_RS05915 (IB935_05915) | - | 1188270..1188692 (-) | 423 | WP_011054682.1 | phage Gp19/Gp15/Gp42 family protein | - |
| IB935_RS05920 (IB935_05920) | - | 1188702..1188902 (-) | 201 | WP_010922460.1 | hypothetical protein | - |
| IB935_RS05925 (IB935_05925) | - | 1188902..1189813 (-) | 912 | WP_011528788.1 | phage major capsid protein | - |
| IB935_RS05930 (IB935_05930) | - | 1189838..1190299 (-) | 462 | WP_010922462.1 | capsid assembly scaffolding protein Gp46 family protein | - |
| IB935_RS05935 (IB935_05935) | - | 1190379..1191794 (-) | 1416 | WP_021299324.1 | phage terminase large subunit-like protein | - |
| IB935_RS05940 (IB935_05940) | - | 1191876..1192112 (-) | 237 | Protein_1129 | hypothetical protein | - |
| IB935_RS05945 (IB935_05945) | - | 1192114..1192380 (-) | 267 | WP_011054745.1 | hypothetical protein | - |
| IB935_RS05950 (IB935_05950) | - | 1192432..1192656 (-) | 225 | WP_002994100.1 | hypothetical protein | - |
| IB935_RS05955 (IB935_05955) | - | 1192662..1194155 (-) | 1494 | WP_010922467.1 | hypothetical protein | - |
| IB935_RS05960 (IB935_05960) | - | 1194148..1195416 (-) | 1269 | WP_010922468.1 | phage portal protein | - |
| IB935_RS05965 (IB935_05965) | - | 1195413..1195769 (-) | 357 | WP_002994106.1 | hypothetical protein | - |
| IB935_RS05970 (IB935_05970) | - | 1195917..1196261 (-) | 345 | WP_011054690.1 | HNH endonuclease signature motif containing protein | - |
| IB935_RS05975 (IB935_05975) | - | 1196369..1196788 (-) | 420 | WP_011528791.1 | DUF1492 domain-containing protein | - |
| IB935_RS05980 (IB935_05980) | - | 1196967..1197294 (-) | 328 | Protein_1137 | recombinase RecT | - |
| IB935_RS05985 (IB935_05985) | - | 1197297..1197626 (-) | 330 | WP_011528796.1 | hypothetical protein | - |
| IB935_RS05990 (IB935_05990) | - | 1197682..1197888 (-) | 207 | WP_002988357.1 | hypothetical protein | - |
| IB935_RS05995 (IB935_05995) | - | 1197897..1198037 (-) | 141 | WP_002988354.1 | hypothetical protein | - |
| IB935_RS06000 (IB935_06000) | - | 1198034..1198268 (-) | 235 | Protein_1141 | hypothetical protein | - |
| IB935_RS06005 (IB935_06005) | - | 1198249..1198452 (-) | 204 | Protein_1142 | DNA replication protein | - |
| IB935_RS06010 (IB935_06010) | - | 1198449..1199045 (+) | 597 | Protein_1143 | tyrosine-type recombinase/integrase | - |
| IB935_RS06015 (IB935_06015) | - | 1199134..1199409 (-) | 276 | WP_002983920.1 | HU family DNA-binding protein | - |
| IB935_RS06020 (IB935_06020) | - | 1199508..1200095 (-) | 588 | WP_002989129.1 | YpmS family protein | - |
| IB935_RS06025 (IB935_06025) | - | 1200073..1200915 (-) | 843 | WP_002992620.1 | SGNH/GDSL hydrolase family protein | - |
Sequence
Protein
Download Length: 60 a.a. Molecular weight: 6840.81 Da Isoelectric Point: 4.7023
>NTDB_id=480992 IB935_RS05815 WP_011528776.1 1172630..1172812(-) (prx) [Streptococcus pyogenes strain BSAC_bs192 isolate Invasive disease]
MLTYNEFKQAIDNGYIAGDTVAIVRKDGQIFDYVLPHEKVKNGEVVTKEKVEEVLVELSR
MLTYNEFKQAIDNGYIAGDTVAIVRKDGQIFDYVLPHEKVKNGEVVTKEKVEEVLVELSR
Nucleotide
Download Length: 183 bp
>NTDB_id=480992 IB935_RS05815 WP_011528776.1 1172630..1172812(-) (prx) [Streptococcus pyogenes strain BSAC_bs192 isolate Invasive disease]
ATGCTAACATACAACGAGTTTAAGCAAGCGATTGACAATGGATATATCGCAGGCGATACAGTAGCGATCGTGCGTAAAGA
CGGACAGATTTTTGATTATGTGTTGCCACATGAGAAAGTAAAGAATGGAGAAGTTGTGACTAAGGAAAAAGTGGAAGAGG
TGCTGGTGGAGCTTTCGAGATAA
ATGCTAACATACAACGAGTTTAAGCAAGCGATTGACAATGGATATATCGCAGGCGATACAGTAGCGATCGTGCGTAAAGA
CGGACAGATTTTTGATTATGTGTTGCCACATGAGAAAGTAAAGAATGGAGAAGTTGTGACTAAGGAAAAAGTGGAAGAGG
TGCTGGTGGAGCTTTCGAGATAA
Domains
No domain identified.
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS8232 |
98.333 |
100 |
0.983 |
| prx | Streptococcus pyogenes MGAS315 |
83.333 |
100 |
0.833 |
| prx | Streptococcus pyogenes MGAS315 |
78.333 |
100 |
0.783 |
| prx | Streptococcus pyogenes MGAS315 |
71.667 |
100 |
0.717 |
| prx | Streptococcus pyogenes MGAS315 |
87.805 |
68.333 |
0.6 |
| prx | Streptococcus pyogenes MGAS315 |
81.395 |
71.667 |
0.583 |
| prx | Streptococcus pyogenes MGAS315 |
76.19 |
70 |
0.533 |