Detailed information
Bioinformatically predicted
Overview
| Name | prx | Type | Regulator |
| Locus tag | IB935_RS04065 | Genome accession | NZ_CP061134 |
| Coordinates | 793879..794067 (+) | Length | 62 a.a. |
| NCBI ID | WP_011528571.1 | Uniprot ID | A0A660A3N3 |
| Organism | Streptococcus pyogenes strain BSAC_bs192 isolate Invasive disease | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 761844..794067 | 793879..794067 | within | 0 |
Gene organization within MGE regions
Location: 761844..794067
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| IB935_RS03870 (IB935_03870) | - | 761844..762479 (+) | 636 | WP_002990114.1 | cystathionine beta-lyase | - |
| IB935_RS03875 (IB935_03875) | rnz | 762494..763423 (+) | 930 | WP_009881223.1 | ribonuclease Z | - |
| IB935_RS03880 (IB935_03880) | - | 763423..764187 (+) | 765 | WP_002984893.1 | SDR family NAD(P)-dependent oxidoreductase | - |
| IB935_RS03885 (IB935_03885) | recJ | 764184..766394 (+) | 2211 | WP_011528535.1 | single-stranded-DNA-specific exonuclease RecJ | - |
| IB935_RS03890 (IB935_03890) | - | 766545..767063 (+) | 519 | WP_002990109.1 | adenine phosphoribosyltransferase | - |
| IB935_RS03895 (IB935_03895) | - | 767144..767827 (+) | 684 | WP_011184446.1 | DnaD domain-containing protein | - |
| IB935_RS03900 (IB935_03900) | nth | 767824..768480 (+) | 657 | WP_002990106.1 | endonuclease III | - |
| IB935_RS03905 (IB935_03905) | - | 768552..769238 (+) | 687 | WP_002990104.1 | tRNA (adenine(22)-N(1))-methyltransferase | - |
| IB935_RS03910 (IB935_03910) | - | 769228..770016 (+) | 789 | WP_021299315.1 | Nif3-like dinuclear metal center hexameric protein | - |
| IB935_RS03915 (IB935_03915) | - | 770056..771162 (+) | 1107 | WP_011528537.1 | NAD(P)/FAD-dependent oxidoreductase | - |
| IB935_RS03920 (IB935_03920) | rfbA | 771220..772089 (+) | 870 | WP_002992970.1 | glucose-1-phosphate thymidylyltransferase RfbA | - |
| IB935_RS03925 (IB935_03925) | - | 772089..772682 (+) | 594 | WP_002990099.1 | dTDP-4-dehydrorhamnose 3,5-epimerase family protein | - |
| IB935_RS03930 (IB935_03930) | rfbB | 772926..773966 (+) | 1041 | WP_002984881.1 | dTDP-glucose 4,6-dehydratase | - |
| IB935_RS03935 (IB935_03935) | - | 774049..774984 (-) | 936 | WP_060388510.1 | tyrosine-type recombinase/integrase | - |
| IB935_RS03940 (IB935_03940) | - | 775131..775451 (+) | 321 | WP_002995960.1 | VRR-NUC domain-containing protein | - |
| IB935_RS03945 (IB935_03945) | - | 775435..775791 (+) | 357 | WP_011018138.1 | hypothetical protein | - |
| IB935_RS09470 | - | 775788..776039 (+) | 252 | WP_011528549.1 | hypothetical protein | - |
| IB935_RS03950 (IB935_03950) | - | 776048..776257 (+) | 210 | Protein_735 | DUF4355 domain-containing protein | - |
| IB935_RS03955 (IB935_03955) | - | 776276..777166 (+) | 891 | WP_011528556.1 | hypothetical protein | - |
| IB935_RS03960 (IB935_03960) | - | 777178..777471 (+) | 294 | WP_011528557.1 | HeH/LEM domain-containing protein | - |
| IB935_RS03965 (IB935_03965) | - | 777485..777829 (+) | 345 | WP_060388512.1 | hypothetical protein | - |
| IB935_RS03970 (IB935_03970) | - | 777826..778137 (+) | 312 | WP_011528559.1 | hypothetical protein | - |
| IB935_RS03975 (IB935_03975) | - | 778134..778529 (+) | 396 | WP_011528560.1 | hypothetical protein | - |
| IB935_RS03980 (IB935_03980) | - | 778531..778941 (+) | 411 | WP_011528561.1 | DUF5072 family protein | - |
| IB935_RS03985 (IB935_03985) | - | 778956..779210 (+) | 255 | WP_231494232.1 | phage major tail protein, TP901-1 family | - |
| IB935_RS03990 (IB935_03990) | - | 779223..779513 (+) | 291 | WP_060388513.1 | hypothetical protein | - |
| IB935_RS03995 (IB935_03995) | - | 779470..781047 (+) | 1578 | WP_231494234.1 | phage tail protein | - |
| IB935_RS04000 (IB935_04000) | - | 781048..782532 (+) | 1485 | WP_011528566.1 | distal tail protein Dit | - |
| IB935_RS04005 (IB935_04005) | - | 782533..785982 (+) | 3450 | WP_011528567.1 | glucosaminidase domain-containing protein | - |
| IB935_RS04010 (IB935_04010) | - | 785987..787849 (+) | 1863 | WP_011528568.1 | DUF859 family phage minor structural protein | - |
| IB935_RS04015 (IB935_04015) | - | 787860..788207 (+) | 348 | WP_009880247.1 | DUF1366 domain-containing protein | - |
| IB935_RS09425 | - | 788221..788343 (+) | 123 | WP_015055953.1 | hypothetical protein | - |
| IB935_RS04020 (IB935_04020) | - | 788357..788680 (+) | 324 | WP_015055952.1 | hypothetical protein | - |
| IB935_RS04025 (IB935_04025) | - | 788680..789012 (+) | 333 | WP_011054798.1 | phage holin | - |
| IB935_RS04030 (IB935_04030) | - | 789014..789778 (+) | 765 | WP_011054797.1 | CHAP domain-containing protein | - |
| IB935_RS04035 (IB935_04035) | - | 789790..790392 (+) | 603 | WP_011054796.1 | hypothetical protein | - |
| IB935_RS04040 (IB935_04040) | - | 790403..791176 (+) | 774 | WP_011528569.1 | hypothetical protein | - |
| IB935_RS04045 (IB935_04045) | - | 791186..791407 (+) | 222 | WP_009880241.1 | hypothetical protein | - |
| IB935_RS04050 (IB935_04050) | - | 791407..792066 (+) | 660 | WP_187835556.1 | hypothetical protein | - |
| IB935_RS04055 (IB935_04055) | - | 792135..792569 (-) | 435 | WP_011017966.1 | hypothetical protein | - |
| IB935_RS04060 (IB935_04060) | sda3 | 792841..793641 (-) | 801 | WP_011285611.1 | streptodornase Sda3 | - |
| IB935_RS04065 (IB935_04065) | prx | 793879..794067 (+) | 189 | WP_011528571.1 | hypothetical protein | Regulator |
Sequence
Protein
Download Length: 62 a.a. Molecular weight: 7224.11 Da Isoelectric Point: 4.0606
>NTDB_id=480986 IB935_RS04065 WP_011528571.1 793879..794067(+) (prx) [Streptococcus pyogenes strain BSAC_bs192 isolate Invasive disease]
MLTYDEFKQAIDREYITGDTVMIVRKNGQIFDYVLPHEEVRNGEVVTIERISDVMAELSESE
MLTYDEFKQAIDREYITGDTVMIVRKNGQIFDYVLPHEEVRNGEVVTIERISDVMAELSESE
Nucleotide
Download Length: 189 bp
>NTDB_id=480986 IB935_RS04065 WP_011528571.1 793879..794067(+) (prx) [Streptococcus pyogenes strain BSAC_bs192 isolate Invasive disease]
ATGCTAACATATGACGAGTTTAAGCAAGCAATCGACCGTGAATATATCACAGGAGACACAGTTATGATCGTGCGCAAGAA
CGGACAGATTTTTGATTATGTGTTGCCGCATGAAGAAGTGAGAAATGGGGAAGTTGTGACAATCGAGCGGATATCAGATG
TTATGGCAGAACTTTCTGAGTCTGAATAA
ATGCTAACATATGACGAGTTTAAGCAAGCAATCGACCGTGAATATATCACAGGAGACACAGTTATGATCGTGCGCAAGAA
CGGACAGATTTTTGATTATGTGTTGCCGCATGAAGAAGTGAGAAATGGGGAAGTTGTGACAATCGAGCGGATATCAGATG
TTATGGCAGAACTTTCTGAGTCTGAATAA
Domains
No domain identified.
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS315 |
76.667 |
96.774 |
0.742 |
| prx | Streptococcus pyogenes MGAS315 |
76.271 |
95.161 |
0.726 |
| prx | Streptococcus pyogenes MGAS8232 |
76.271 |
95.161 |
0.726 |
| prx | Streptococcus pyogenes MGAS315 |
71.667 |
96.774 |
0.694 |
| prx | Streptococcus pyogenes MGAS315 |
90.698 |
69.355 |
0.629 |
| prx | Streptococcus pyogenes MGAS315 |
85.366 |
66.129 |
0.565 |
| prx | Streptococcus pyogenes MGAS315 |
76.19 |
67.742 |
0.516 |