Detailed information
Overview
| Name | prx | Type | Regulator |
| Locus tag | IB936_RS05740 | Genome accession | NZ_CP061133 |
| Coordinates | 1166455..1166637 (-) | Length | 60 a.a. |
| NCBI ID | WP_011528776.1 | Uniprot ID | A0A660A5W9 |
| Organism | Streptococcus pyogenes strain BSAC_bs472 isolate Invasive disease | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1166455..1194758 | 1166455..1166637 | within | 0 |
Gene organization within MGE regions
Location: 1166455..1194758
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| IB936_RS05740 (IB936_05740) | prx | 1166455..1166637 (-) | 183 | WP_011528776.1 | hypothetical protein | Regulator |
| IB936_RS05745 (IB936_05745) | entC3 | 1166750..1167532 (-) | 783 | WP_002988472.1 | enterotoxin type C3 EntC3 | - |
| IB936_RS05750 (IB936_05750) | - | 1167780..1168904 (-) | 1125 | WP_002988467.1 | Fic family protein | - |
| IB936_RS05755 (IB936_05755) | - | 1169040..1170257 (-) | 1218 | WP_011528778.1 | peptidoglycan amidohydrolase family protein | - |
| IB936_RS05760 (IB936_05760) | - | 1170376..1170603 (-) | 228 | WP_003058873.1 | phage holin | - |
| IB936_RS05765 (IB936_05765) | - | 1170600..1170872 (-) | 273 | WP_011017397.1 | hypothetical protein | - |
| IB936_RS05770 (IB936_05770) | - | 1170884..1171516 (-) | 633 | WP_011528779.1 | hypothetical protein | - |
| IB936_RS05775 (IB936_05775) | - | 1171519..1171947 (-) | 429 | WP_011528780.1 | DUF1617 family protein | - |
| IB936_RS05780 (IB936_05780) | - | 1171956..1173737 (-) | 1782 | WP_011528781.1 | gp58-like family protein | - |
| IB936_RS05785 (IB936_05785) | hylP | 1173752..1174867 (-) | 1116 | WP_011528782.1 | hyaluronoglucosaminidase | - |
| IB936_RS05790 (IB936_05790) | - | 1174864..1176840 (-) | 1977 | WP_011528783.1 | phage tail spike protein | - |
| IB936_RS05795 (IB936_05795) | - | 1176822..1177517 (-) | 696 | WP_002992579.1 | hypothetical protein | - |
| IB936_RS05800 (IB936_05800) | - | 1177514..1179871 (-) | 2358 | WP_011528784.1 | hypothetical protein | - |
| IB936_RS05805 (IB936_05805) | - | 1179871..1180242 (-) | 372 | WP_011528785.1 | DUF5361 domain-containing protein | - |
| IB936_RS05810 (IB936_05810) | - | 1180257..1180520 (-) | 264 | WP_003047548.1 | hypothetical protein | - |
| IB936_RS05815 (IB936_05815) | - | 1180531..1181109 (-) | 579 | WP_014635577.1 | hypothetical protein | - |
| IB936_RS05825 (IB936_05825) | - | 1181233..1181568 (-) | 336 | WP_011528787.1 | hypothetical protein | - |
| IB936_RS05830 (IB936_05830) | - | 1181569..1181805 (-) | 237 | WP_000032787.1 | hypothetical protein | - |
| IB936_RS05835 (IB936_05835) | - | 1181798..1182135 (-) | 338 | Protein_1122 | hypothetical protein | - |
| IB936_RS05840 (IB936_05840) | - | 1182095..1182517 (-) | 423 | WP_011054682.1 | phage Gp19/Gp15/Gp42 family protein | - |
| IB936_RS05845 (IB936_05845) | - | 1182527..1182727 (-) | 201 | WP_010922460.1 | hypothetical protein | - |
| IB936_RS05850 (IB936_05850) | - | 1182727..1183638 (-) | 912 | WP_011528788.1 | phage major capsid protein | - |
| IB936_RS05855 (IB936_05855) | - | 1183663..1184124 (-) | 462 | WP_010922462.1 | capsid assembly scaffolding protein Gp46 family protein | - |
| IB936_RS05860 (IB936_05860) | - | 1184204..1185619 (-) | 1416 | WP_021299324.1 | phage terminase large subunit-like protein | - |
| IB936_RS05865 (IB936_05865) | - | 1185701..1185937 (-) | 237 | Protein_1128 | hypothetical protein | - |
| IB936_RS05870 (IB936_05870) | - | 1185939..1186205 (-) | 267 | WP_011054745.1 | hypothetical protein | - |
| IB936_RS05875 (IB936_05875) | - | 1186257..1186481 (-) | 225 | WP_002994100.1 | hypothetical protein | - |
| IB936_RS05880 (IB936_05880) | - | 1186487..1187980 (-) | 1494 | WP_010922467.1 | hypothetical protein | - |
| IB936_RS05885 (IB936_05885) | - | 1187973..1189241 (-) | 1269 | WP_010922468.1 | phage portal protein | - |
| IB936_RS05890 (IB936_05890) | - | 1189238..1189594 (-) | 357 | WP_002994106.1 | hypothetical protein | - |
| IB936_RS05895 (IB936_05895) | - | 1189742..1190086 (-) | 345 | WP_011054690.1 | HNH endonuclease signature motif containing protein | - |
| IB936_RS05900 (IB936_05900) | - | 1190194..1190613 (-) | 420 | WP_011528791.1 | DUF1492 domain-containing protein | - |
| IB936_RS05905 (IB936_05905) | - | 1190792..1191119 (-) | 328 | Protein_1136 | recombinase RecT | - |
| IB936_RS05910 (IB936_05910) | - | 1191122..1191451 (-) | 330 | WP_011528796.1 | hypothetical protein | - |
| IB936_RS05915 (IB936_05915) | - | 1191507..1191713 (-) | 207 | WP_002988357.1 | hypothetical protein | - |
| IB936_RS05920 (IB936_05920) | - | 1191722..1191862 (-) | 141 | WP_002988354.1 | hypothetical protein | - |
| IB936_RS05925 (IB936_05925) | - | 1191859..1192093 (-) | 235 | Protein_1140 | hypothetical protein | - |
| IB936_RS05930 (IB936_05930) | - | 1192074..1192277 (-) | 204 | Protein_1141 | DNA replication protein | - |
| IB936_RS05935 (IB936_05935) | - | 1192274..1192870 (+) | 597 | Protein_1142 | tyrosine-type recombinase/integrase | - |
| IB936_RS05940 (IB936_05940) | - | 1192959..1193234 (-) | 276 | WP_002983920.1 | HU family DNA-binding protein | - |
| IB936_RS05945 (IB936_05945) | - | 1193333..1193920 (-) | 588 | WP_002989129.1 | YpmS family protein | - |
| IB936_RS05950 (IB936_05950) | - | 1193898..1194740 (-) | 843 | WP_002992620.1 | SGNH/GDSL hydrolase family protein | - |
Sequence
Protein
Download Length: 60 a.a. Molecular weight: 6840.81 Da Isoelectric Point: 4.7023
>NTDB_id=480936 IB936_RS05740 WP_011528776.1 1166455..1166637(-) (prx) [Streptococcus pyogenes strain BSAC_bs472 isolate Invasive disease]
MLTYNEFKQAIDNGYIAGDTVAIVRKDGQIFDYVLPHEKVKNGEVVTKEKVEEVLVELSR
MLTYNEFKQAIDNGYIAGDTVAIVRKDGQIFDYVLPHEKVKNGEVVTKEKVEEVLVELSR
Nucleotide
Download Length: 183 bp
>NTDB_id=480936 IB936_RS05740 WP_011528776.1 1166455..1166637(-) (prx) [Streptococcus pyogenes strain BSAC_bs472 isolate Invasive disease]
ATGCTAACATACAACGAGTTTAAGCAAGCGATTGACAATGGATATATCGCAGGCGATACAGTAGCGATCGTGCGTAAAGA
CGGACAGATTTTTGATTATGTGTTGCCACATGAGAAAGTAAAGAATGGAGAAGTTGTGACTAAGGAAAAAGTGGAAGAGG
TGCTGGTGGAGCTTTCGAGATAA
ATGCTAACATACAACGAGTTTAAGCAAGCGATTGACAATGGATATATCGCAGGCGATACAGTAGCGATCGTGCGTAAAGA
CGGACAGATTTTTGATTATGTGTTGCCACATGAGAAAGTAAAGAATGGAGAAGTTGTGACTAAGGAAAAAGTGGAAGAGG
TGCTGGTGGAGCTTTCGAGATAA
Domains
No domain identified.
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS8232 |
98.333 |
100 |
0.983 |
| prx | Streptococcus pyogenes MGAS315 |
83.333 |
100 |
0.833 |
| prx | Streptococcus pyogenes MGAS315 |
78.333 |
100 |
0.783 |
| prx | Streptococcus pyogenes MGAS315 |
71.667 |
100 |
0.717 |
| prx | Streptococcus pyogenes MGAS315 |
87.805 |
68.333 |
0.6 |
| prx | Streptococcus pyogenes MGAS315 |
81.395 |
71.667 |
0.583 |
| prx | Streptococcus pyogenes MGAS315 |
76.19 |
70 |
0.533 |