Detailed information
Bioinformatically predicted
Overview
| Name | prx | Type | Regulator |
| Locus tag | IB937_RS03400 | Genome accession | NZ_CP061132 |
| Coordinates | 658636..658818 (+) | Length | 60 a.a. |
| NCBI ID | WP_011528776.1 | Uniprot ID | A0A660A5W9 |
| Organism | Streptococcus pyogenes strain BSAC_bs1388 isolate Invasive disease | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 623152..658818 | 658636..658818 | within | 0 |
Gene organization within MGE regions
Location: 623152..658818
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| IB937_RS03135 (IB937_03135) | - | 623152..623427 (+) | 276 | WP_002983920.1 | HU family DNA-binding protein | - |
| IB937_RS03140 (IB937_03140) | - | 623516..624658 (-) | 1143 | WP_003051793.1 | tyrosine-type recombinase/integrase | - |
| IB937_RS03145 (IB937_03145) | - | 624782..625300 (-) | 519 | WP_011528799.1 | HIRAN domain-containing protein | - |
| IB937_RS03150 (IB937_03150) | - | 625312..626067 (-) | 756 | WP_010922480.1 | helix-turn-helix domain-containing protein | - |
| IB937_RS03155 (IB937_03155) | - | 626269..626481 (+) | 213 | WP_010922479.1 | helix-turn-helix domain-containing protein | - |
| IB937_RS03160 (IB937_03160) | - | 626751..627062 (+) | 312 | WP_010922478.1 | excisionase | - |
| IB937_RS03165 (IB937_03165) | - | 627064..627249 (+) | 186 | WP_010922477.1 | hypothetical protein | - |
| IB937_RS09800 | - | 627343..627612 (+) | 270 | WP_011106700.1 | replication protein | - |
| IB937_RS03170 (IB937_03170) | - | 627738..628124 (+) | 387 | WP_011017564.1 | DnaD domain-containing protein | - |
| IB937_RS03175 (IB937_03175) | - | 628105..628339 (+) | 235 | Protein_566 | hypothetical protein | - |
| IB937_RS03180 (IB937_03180) | - | 628336..628476 (+) | 141 | WP_002988354.1 | hypothetical protein | - |
| IB937_RS03185 (IB937_03185) | - | 628485..628691 (+) | 207 | WP_002988357.1 | hypothetical protein | - |
| IB937_RS03190 (IB937_03190) | - | 628747..629076 (+) | 330 | WP_011528796.1 | hypothetical protein | - |
| IB937_RS03195 (IB937_03195) | - | 629079..630000 (+) | 922 | Protein_570 | recombinase RecT | - |
| IB937_RS03200 (IB937_03200) | - | 629997..630197 (+) | 201 | WP_000594115.1 | hypothetical protein | - |
| IB937_RS03205 (IB937_03205) | - | 630190..630987 (+) | 798 | WP_011054699.1 | PD-(D/E)XK nuclease-like domain-containing protein | - |
| IB937_RS03210 (IB937_03210) | - | 631352..631747 (+) | 396 | WP_011054698.1 | Cas9 inhibitor AcrIIA9 family protein | - |
| IB937_RS03215 (IB937_03215) | - | 631744..633090 (+) | 1347 | WP_011054697.1 | PcfJ domain-containing protein | - |
| IB937_RS03220 (IB937_03220) | - | 633101..633433 (+) | 333 | WP_011184741.1 | hypothetical protein | - |
| IB937_RS03225 (IB937_03225) | - | 633430..633942 (+) | 513 | WP_011054695.1 | hypothetical protein | - |
| IB937_RS03230 (IB937_03230) | - | 633978..634295 (+) | 318 | WP_011054694.1 | DUF1372 family protein | - |
| IB937_RS03235 (IB937_03235) | - | 634292..634447 (+) | 156 | WP_011054693.1 | hypothetical protein | - |
| IB937_RS03240 (IB937_03240) | - | 634444..634695 (+) | 252 | WP_011054692.1 | hypothetical protein | - |
| IB937_RS03245 (IB937_03245) | - | 634771..635190 (+) | 420 | WP_011528791.1 | DUF1492 domain-containing protein | - |
| IB937_RS03250 (IB937_03250) | - | 635298..635642 (+) | 345 | WP_011054690.1 | HNH endonuclease signature motif containing protein | - |
| IB937_RS03255 (IB937_03255) | - | 635790..636146 (+) | 357 | WP_002994106.1 | hypothetical protein | - |
| IB937_RS03260 (IB937_03260) | - | 636143..637411 (+) | 1269 | WP_010922468.1 | phage portal protein | - |
| IB937_RS03265 (IB937_03265) | - | 637404..638897 (+) | 1494 | WP_010922467.1 | hypothetical protein | - |
| IB937_RS03270 (IB937_03270) | - | 638903..639127 (+) | 225 | WP_002994100.1 | hypothetical protein | - |
| IB937_RS03275 (IB937_03275) | - | 639179..639445 (+) | 267 | WP_011054745.1 | hypothetical protein | - |
| IB937_RS03280 (IB937_03280) | - | 639447..639683 (+) | 237 | Protein_587 | hypothetical protein | - |
| IB937_RS03285 (IB937_03285) | - | 639765..641180 (+) | 1416 | WP_021299324.1 | phage terminase large subunit-like protein | - |
| IB937_RS03290 (IB937_03290) | - | 641260..641721 (+) | 462 | WP_010922462.1 | capsid assembly scaffolding protein Gp46 family protein | - |
| IB937_RS03295 (IB937_03295) | - | 641746..642657 (+) | 912 | WP_011528788.1 | phage major capsid protein | - |
| IB937_RS03300 (IB937_03300) | - | 642657..642857 (+) | 201 | WP_010922460.1 | hypothetical protein | - |
| IB937_RS03305 (IB937_03305) | - | 642867..643289 (+) | 423 | WP_011054682.1 | phage Gp19/Gp15/Gp42 family protein | - |
| IB937_RS03310 (IB937_03310) | - | 643249..643587 (+) | 339 | WP_011054681.1 | hypothetical protein | - |
| IB937_RS03315 (IB937_03315) | - | 643580..643816 (+) | 237 | WP_000032787.1 | hypothetical protein | - |
| IB937_RS03320 (IB937_03320) | - | 643817..644152 (+) | 336 | WP_011528787.1 | hypothetical protein | - |
| IB937_RS03325 (IB937_03325) | - | 644164..644742 (+) | 579 | WP_014635577.1 | hypothetical protein | - |
| IB937_RS03330 (IB937_03330) | - | 644753..645016 (+) | 264 | WP_003047548.1 | hypothetical protein | - |
| IB937_RS03335 (IB937_03335) | - | 645031..645402 (+) | 372 | WP_011528785.1 | DUF5361 domain-containing protein | - |
| IB937_RS03340 (IB937_03340) | - | 645402..647759 (+) | 2358 | WP_011528784.1 | hypothetical protein | - |
| IB937_RS03345 (IB937_03345) | - | 647756..648451 (+) | 696 | WP_002992579.1 | hypothetical protein | - |
| IB937_RS03350 (IB937_03350) | - | 648433..650409 (+) | 1977 | WP_011528783.1 | phage tail spike protein | - |
| IB937_RS03355 (IB937_03355) | hylP | 650406..651521 (+) | 1116 | WP_011528782.1 | hyaluronoglucosaminidase | - |
| IB937_RS03360 (IB937_03360) | - | 651536..653317 (+) | 1782 | WP_011528781.1 | gp58-like family protein | - |
| IB937_RS03365 (IB937_03365) | - | 653326..653754 (+) | 429 | WP_011528780.1 | DUF1617 family protein | - |
| IB937_RS03370 (IB937_03370) | - | 653757..654389 (+) | 633 | WP_011528779.1 | hypothetical protein | - |
| IB937_RS03375 (IB937_03375) | - | 654401..654673 (+) | 273 | WP_011017397.1 | hypothetical protein | - |
| IB937_RS03380 (IB937_03380) | - | 654670..654897 (+) | 228 | WP_003058873.1 | phage holin | - |
| IB937_RS03385 (IB937_03385) | - | 655016..656233 (+) | 1218 | WP_011528778.1 | peptidoglycan amidohydrolase family protein | - |
| IB937_RS03390 (IB937_03390) | - | 656369..657493 (+) | 1125 | WP_002988467.1 | Fic family protein | - |
| IB937_RS03395 (IB937_03395) | entC3 | 657741..658523 (+) | 783 | WP_002988472.1 | enterotoxin type C3 EntC3 | - |
| IB937_RS03400 (IB937_03400) | prx | 658636..658818 (+) | 183 | WP_011528776.1 | hypothetical protein | Regulator |
Sequence
Protein
Download Length: 60 a.a. Molecular weight: 6840.81 Da Isoelectric Point: 4.7023
>NTDB_id=480871 IB937_RS03400 WP_011528776.1 658636..658818(+) (prx) [Streptococcus pyogenes strain BSAC_bs1388 isolate Invasive disease]
MLTYNEFKQAIDNGYIAGDTVAIVRKDGQIFDYVLPHEKVKNGEVVTKEKVEEVLVELSR
MLTYNEFKQAIDNGYIAGDTVAIVRKDGQIFDYVLPHEKVKNGEVVTKEKVEEVLVELSR
Nucleotide
Download Length: 183 bp
>NTDB_id=480871 IB937_RS03400 WP_011528776.1 658636..658818(+) (prx) [Streptococcus pyogenes strain BSAC_bs1388 isolate Invasive disease]
ATGCTAACATACAACGAGTTTAAGCAAGCGATTGACAATGGATATATCGCAGGCGATACAGTAGCGATCGTGCGTAAAGA
CGGACAGATTTTTGATTATGTGTTGCCACATGAGAAAGTAAAGAATGGAGAAGTTGTGACTAAGGAAAAAGTGGAAGAGG
TGCTGGTGGAGCTTTCGAGATAA
ATGCTAACATACAACGAGTTTAAGCAAGCGATTGACAATGGATATATCGCAGGCGATACAGTAGCGATCGTGCGTAAAGA
CGGACAGATTTTTGATTATGTGTTGCCACATGAGAAAGTAAAGAATGGAGAAGTTGTGACTAAGGAAAAAGTGGAAGAGG
TGCTGGTGGAGCTTTCGAGATAA
Domains
No domain identified.
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS8232 |
98.333 |
100 |
0.983 |
| prx | Streptococcus pyogenes MGAS315 |
83.333 |
100 |
0.833 |
| prx | Streptococcus pyogenes MGAS315 |
78.333 |
100 |
0.783 |
| prx | Streptococcus pyogenes MGAS315 |
71.667 |
100 |
0.717 |
| prx | Streptococcus pyogenes MGAS315 |
87.805 |
68.333 |
0.6 |
| prx | Streptococcus pyogenes MGAS315 |
81.395 |
71.667 |
0.583 |
| prx | Streptococcus pyogenes MGAS315 |
76.19 |
70 |
0.533 |