Detailed information
Overview
| Name | prx | Type | Regulator |
| Locus tag | IB938_RS06335 | Genome accession | NZ_CP061131 |
| Coordinates | 1242472..1242654 (-) | Length | 60 a.a. |
| NCBI ID | WP_011528776.1 | Uniprot ID | A0A660A5W9 |
| Organism | Streptococcus pyogenes strain BSAC_bs1802 isolate Invasive disease | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1242472..1278151 | 1242472..1242654 | within | 0 |
Gene organization within MGE regions
Location: 1242472..1278151
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| IB938_RS06335 (IB938_06335) | prx | 1242472..1242654 (-) | 183 | WP_011528776.1 | hypothetical protein | Regulator |
| IB938_RS06340 (IB938_06340) | entC3 | 1242767..1243549 (-) | 783 | WP_002988472.1 | enterotoxin type C3 EntC3 | - |
| IB938_RS06345 (IB938_06345) | - | 1243797..1244921 (-) | 1125 | WP_002988467.1 | Fic family protein | - |
| IB938_RS06350 (IB938_06350) | - | 1245057..1246274 (-) | 1218 | WP_011528778.1 | peptidoglycan amidohydrolase family protein | - |
| IB938_RS06355 (IB938_06355) | - | 1246393..1246620 (-) | 228 | WP_003058873.1 | phage holin | - |
| IB938_RS06360 (IB938_06360) | - | 1246617..1246889 (-) | 273 | WP_011017397.1 | hypothetical protein | - |
| IB938_RS06365 (IB938_06365) | - | 1246901..1247533 (-) | 633 | WP_011528779.1 | hypothetical protein | - |
| IB938_RS06370 (IB938_06370) | - | 1247536..1247964 (-) | 429 | WP_011528780.1 | DUF1617 family protein | - |
| IB938_RS06375 (IB938_06375) | - | 1247973..1249754 (-) | 1782 | WP_011528781.1 | gp58-like family protein | - |
| IB938_RS06380 (IB938_06380) | hylP | 1249769..1250884 (-) | 1116 | WP_011528782.1 | hyaluronoglucosaminidase | - |
| IB938_RS06385 (IB938_06385) | - | 1250881..1252857 (-) | 1977 | WP_047235223.1 | phage tail spike protein | - |
| IB938_RS06390 (IB938_06390) | - | 1252839..1253534 (-) | 696 | WP_047235222.1 | hypothetical protein | - |
| IB938_RS06395 (IB938_06395) | - | 1253531..1255888 (-) | 2358 | WP_011528784.1 | hypothetical protein | - |
| IB938_RS06400 (IB938_06400) | - | 1255888..1256259 (-) | 372 | WP_011528785.1 | DUF5361 domain-containing protein | - |
| IB938_RS06405 (IB938_06405) | - | 1256274..1256537 (-) | 264 | WP_003047548.1 | hypothetical protein | - |
| IB938_RS06410 (IB938_06410) | - | 1256548..1257126 (-) | 579 | WP_014635577.1 | hypothetical protein | - |
| IB938_RS06415 (IB938_06415) | - | 1257138..1257473 (-) | 336 | WP_011528787.1 | hypothetical protein | - |
| IB938_RS06420 (IB938_06420) | - | 1257474..1257710 (-) | 237 | WP_000032787.1 | hypothetical protein | - |
| IB938_RS06425 (IB938_06425) | - | 1257703..1258041 (-) | 339 | WP_011054681.1 | hypothetical protein | - |
| IB938_RS06430 (IB938_06430) | - | 1258001..1258423 (-) | 423 | WP_011054682.1 | phage Gp19/Gp15/Gp42 family protein | - |
| IB938_RS06435 (IB938_06435) | - | 1258433..1258633 (-) | 201 | WP_010922460.1 | hypothetical protein | - |
| IB938_RS06440 (IB938_06440) | - | 1258633..1259544 (-) | 912 | WP_011528788.1 | phage major capsid protein | - |
| IB938_RS06445 (IB938_06445) | - | 1259569..1260030 (-) | 462 | WP_010922462.1 | capsid assembly scaffolding protein Gp46 family protein | - |
| IB938_RS06450 (IB938_06450) | - | 1260110..1261525 (-) | 1416 | WP_021299324.1 | phage terminase large subunit-like protein | - |
| IB938_RS06455 (IB938_06455) | - | 1261607..1261843 (-) | 237 | Protein_1236 | hypothetical protein | - |
| IB938_RS06460 (IB938_06460) | - | 1261845..1262111 (-) | 267 | WP_011054745.1 | hypothetical protein | - |
| IB938_RS06465 (IB938_06465) | - | 1262163..1262387 (-) | 225 | WP_002994100.1 | hypothetical protein | - |
| IB938_RS06470 (IB938_06470) | - | 1262393..1263886 (-) | 1494 | WP_010922467.1 | hypothetical protein | - |
| IB938_RS06475 (IB938_06475) | - | 1263879..1265147 (-) | 1269 | WP_010922468.1 | phage portal protein | - |
| IB938_RS06480 (IB938_06480) | - | 1265144..1265500 (-) | 357 | WP_002994106.1 | hypothetical protein | - |
| IB938_RS06485 (IB938_06485) | - | 1265648..1265992 (-) | 345 | WP_011054690.1 | HNH endonuclease signature motif containing protein | - |
| IB938_RS06490 (IB938_06490) | - | 1266100..1266519 (-) | 420 | WP_011528791.1 | DUF1492 domain-containing protein | - |
| IB938_RS06495 (IB938_06495) | - | 1266595..1266846 (-) | 252 | WP_011054692.1 | hypothetical protein | - |
| IB938_RS06500 (IB938_06500) | - | 1266843..1266998 (-) | 156 | WP_011054693.1 | hypothetical protein | - |
| IB938_RS06505 (IB938_06505) | - | 1266995..1267312 (-) | 318 | WP_011054694.1 | DUF1372 family protein | - |
| IB938_RS06510 (IB938_06510) | - | 1267348..1267860 (-) | 513 | WP_011054695.1 | hypothetical protein | - |
| IB938_RS06515 (IB938_06515) | - | 1267857..1268189 (-) | 333 | WP_011184741.1 | hypothetical protein | - |
| IB938_RS06520 (IB938_06520) | - | 1268200..1269546 (-) | 1347 | WP_011054697.1 | PcfJ domain-containing protein | - |
| IB938_RS06525 (IB938_06525) | - | 1269543..1269938 (-) | 396 | WP_011054698.1 | Cas9 inhibitor AcrIIA9 family protein | - |
| IB938_RS06530 (IB938_06530) | - | 1270303..1271100 (-) | 798 | WP_011054699.1 | PD-(D/E)XK nuclease-like domain-containing protein | - |
| IB938_RS06535 (IB938_06535) | - | 1271093..1271293 (-) | 201 | WP_000594115.1 | hypothetical protein | - |
| IB938_RS06540 (IB938_06540) | - | 1271290..1272216 (-) | 927 | WP_011054700.1 | recombinase RecT | - |
| IB938_RS06545 (IB938_06545) | - | 1272219..1272548 (-) | 330 | WP_011528796.1 | hypothetical protein | - |
| IB938_RS06550 (IB938_06550) | - | 1272604..1272810 (-) | 207 | WP_011017565.1 | hypothetical protein | - |
| IB938_RS06555 (IB938_06555) | - | 1272819..1272959 (-) | 141 | WP_011017992.1 | hypothetical protein | - |
| IB938_RS06560 (IB938_06560) | - | 1272956..1273189 (-) | 234 | WP_002985387.1 | hypothetical protein | - |
| IB938_RS06565 (IB938_06565) | - | 1273170..1273556 (-) | 387 | WP_002985388.1 | DnaD domain-containing protein | - |
| IB938_RS09695 | - | 1273715..1273954 (-) | 240 | WP_002985390.1 | hypothetical protein | - |
| IB938_RS06570 (IB938_06570) | - | 1274054..1274239 (-) | 186 | WP_061046295.1 | hypothetical protein | - |
| IB938_RS06575 (IB938_06575) | - | 1274241..1274552 (-) | 312 | WP_010922478.1 | excisionase | - |
| IB938_RS06580 (IB938_06580) | - | 1274822..1275034 (-) | 213 | WP_010922479.1 | helix-turn-helix domain-containing protein | - |
| IB938_RS06585 (IB938_06585) | - | 1275236..1275991 (+) | 756 | WP_010922480.1 | helix-turn-helix domain-containing protein | - |
| IB938_RS06590 (IB938_06590) | - | 1276003..1276521 (+) | 519 | WP_011528799.1 | HIRAN domain-containing protein | - |
| IB938_RS06595 (IB938_06595) | - | 1276645..1277787 (+) | 1143 | WP_003051793.1 | tyrosine-type recombinase/integrase | - |
| IB938_RS06600 (IB938_06600) | - | 1277876..1278151 (-) | 276 | WP_002983920.1 | HU family DNA-binding protein | - |
Sequence
Protein
Download Length: 60 a.a. Molecular weight: 6840.81 Da Isoelectric Point: 4.7023
>NTDB_id=480825 IB938_RS06335 WP_011528776.1 1242472..1242654(-) (prx) [Streptococcus pyogenes strain BSAC_bs1802 isolate Invasive disease]
MLTYNEFKQAIDNGYIAGDTVAIVRKDGQIFDYVLPHEKVKNGEVVTKEKVEEVLVELSR
MLTYNEFKQAIDNGYIAGDTVAIVRKDGQIFDYVLPHEKVKNGEVVTKEKVEEVLVELSR
Nucleotide
Download Length: 183 bp
>NTDB_id=480825 IB938_RS06335 WP_011528776.1 1242472..1242654(-) (prx) [Streptococcus pyogenes strain BSAC_bs1802 isolate Invasive disease]
ATGCTAACATACAACGAGTTTAAGCAAGCGATTGACAATGGATATATCGCAGGCGATACAGTAGCGATCGTGCGTAAAGA
CGGACAGATTTTTGATTATGTGTTGCCACATGAGAAAGTAAAGAATGGAGAAGTTGTGACTAAGGAAAAAGTGGAAGAGG
TGCTGGTGGAGCTTTCGAGATAA
ATGCTAACATACAACGAGTTTAAGCAAGCGATTGACAATGGATATATCGCAGGCGATACAGTAGCGATCGTGCGTAAAGA
CGGACAGATTTTTGATTATGTGTTGCCACATGAGAAAGTAAAGAATGGAGAAGTTGTGACTAAGGAAAAAGTGGAAGAGG
TGCTGGTGGAGCTTTCGAGATAA
Domains
No domain identified.
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS8232 |
98.333 |
100 |
0.983 |
| prx | Streptococcus pyogenes MGAS315 |
83.333 |
100 |
0.833 |
| prx | Streptococcus pyogenes MGAS315 |
78.333 |
100 |
0.783 |
| prx | Streptococcus pyogenes MGAS315 |
71.667 |
100 |
0.717 |
| prx | Streptococcus pyogenes MGAS315 |
87.805 |
68.333 |
0.6 |
| prx | Streptococcus pyogenes MGAS315 |
81.395 |
71.667 |
0.583 |
| prx | Streptococcus pyogenes MGAS315 |
76.19 |
70 |
0.533 |