Detailed information
Bioinformatically predicted
Overview
| Name | prx | Type | Regulator |
| Locus tag | IB938_RS04580 | Genome accession | NZ_CP061131 |
| Coordinates | 863733..863921 (+) | Length | 62 a.a. |
| NCBI ID | WP_011528571.1 | Uniprot ID | A0A660A3N3 |
| Organism | Streptococcus pyogenes strain BSAC_bs1802 isolate Invasive disease | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 831698..863921 | 863733..863921 | within | 0 |
Gene organization within MGE regions
Location: 831698..863921
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| IB938_RS04385 (IB938_04385) | - | 831698..832333 (+) | 636 | WP_002990114.1 | cystathionine beta-lyase | - |
| IB938_RS04390 (IB938_04390) | rnz | 832348..833277 (+) | 930 | WP_009881223.1 | ribonuclease Z | - |
| IB938_RS04395 (IB938_04395) | - | 833277..834041 (+) | 765 | WP_002984893.1 | SDR family NAD(P)-dependent oxidoreductase | - |
| IB938_RS04400 (IB938_04400) | recJ | 834038..836248 (+) | 2211 | WP_011528535.1 | single-stranded-DNA-specific exonuclease RecJ | - |
| IB938_RS04405 (IB938_04405) | - | 836399..836917 (+) | 519 | WP_002990109.1 | adenine phosphoribosyltransferase | - |
| IB938_RS04410 (IB938_04410) | - | 836998..837681 (+) | 684 | WP_011184446.1 | DnaD domain-containing protein | - |
| IB938_RS04415 (IB938_04415) | nth | 837678..838334 (+) | 657 | WP_002990106.1 | endonuclease III | - |
| IB938_RS04420 (IB938_04420) | - | 838406..839092 (+) | 687 | WP_002990104.1 | tRNA (adenine(22)-N(1))-methyltransferase | - |
| IB938_RS04425 (IB938_04425) | - | 839082..839870 (+) | 789 | WP_021299315.1 | Nif3-like dinuclear metal center hexameric protein | - |
| IB938_RS04430 (IB938_04430) | - | 839910..841016 (+) | 1107 | WP_011528537.1 | NAD(P)/FAD-dependent oxidoreductase | - |
| IB938_RS04435 (IB938_04435) | rfbA | 841074..841943 (+) | 870 | WP_002992970.1 | glucose-1-phosphate thymidylyltransferase RfbA | - |
| IB938_RS04440 (IB938_04440) | - | 841943..842536 (+) | 594 | WP_002990099.1 | dTDP-4-dehydrorhamnose 3,5-epimerase family protein | - |
| IB938_RS04445 (IB938_04445) | rfbB | 842780..843820 (+) | 1041 | WP_002984881.1 | dTDP-glucose 4,6-dehydratase | - |
| IB938_RS04450 (IB938_04450) | - | 843903..844838 (-) | 936 | WP_060388510.1 | tyrosine-type recombinase/integrase | - |
| IB938_RS04455 (IB938_04455) | - | 844985..845305 (+) | 321 | WP_002995960.1 | VRR-NUC domain-containing protein | - |
| IB938_RS04460 (IB938_04460) | - | 845289..845645 (+) | 357 | WP_011018138.1 | hypothetical protein | - |
| IB938_RS09805 | - | 845642..845893 (+) | 252 | WP_011528549.1 | hypothetical protein | - |
| IB938_RS04465 (IB938_04465) | - | 845902..846111 (+) | 210 | Protein_842 | DUF4355 domain-containing protein | - |
| IB938_RS04470 (IB938_04470) | - | 846130..847020 (+) | 891 | WP_011528556.1 | hypothetical protein | - |
| IB938_RS04475 (IB938_04475) | - | 847032..847325 (+) | 294 | WP_011528557.1 | HeH/LEM domain-containing protein | - |
| IB938_RS04480 (IB938_04480) | - | 847339..847683 (+) | 345 | WP_060388512.1 | hypothetical protein | - |
| IB938_RS04485 (IB938_04485) | - | 847680..847991 (+) | 312 | WP_011528559.1 | hypothetical protein | - |
| IB938_RS04490 (IB938_04490) | - | 847988..848383 (+) | 396 | WP_011528560.1 | hypothetical protein | - |
| IB938_RS04495 (IB938_04495) | - | 848385..848795 (+) | 411 | WP_011528561.1 | DUF5072 family protein | - |
| IB938_RS04500 (IB938_04500) | - | 848810..849064 (+) | 255 | WP_231494232.1 | phage major tail protein, TP901-1 family | - |
| IB938_RS04505 (IB938_04505) | - | 849077..849367 (+) | 291 | WP_060388513.1 | hypothetical protein | - |
| IB938_RS04510 (IB938_04510) | - | 849324..850901 (+) | 1578 | WP_231494234.1 | phage tail protein | - |
| IB938_RS04515 (IB938_04515) | - | 850902..852386 (+) | 1485 | WP_011528566.1 | distal tail protein Dit | - |
| IB938_RS04520 (IB938_04520) | - | 852387..855836 (+) | 3450 | WP_011528567.1 | glucosaminidase domain-containing protein | - |
| IB938_RS04525 (IB938_04525) | - | 855841..857703 (+) | 1863 | WP_011528568.1 | DUF859 family phage minor structural protein | - |
| IB938_RS04530 (IB938_04530) | - | 857714..858061 (+) | 348 | WP_009880247.1 | DUF1366 domain-containing protein | - |
| IB938_RS09765 | - | 858075..858197 (+) | 123 | WP_015055953.1 | hypothetical protein | - |
| IB938_RS04535 (IB938_04535) | - | 858211..858534 (+) | 324 | WP_015055952.1 | hypothetical protein | - |
| IB938_RS04540 (IB938_04540) | - | 858534..858866 (+) | 333 | WP_011054798.1 | phage holin | - |
| IB938_RS04545 (IB938_04545) | - | 858868..859632 (+) | 765 | WP_011054797.1 | CHAP domain-containing protein | - |
| IB938_RS04550 (IB938_04550) | - | 859644..860246 (+) | 603 | WP_011054796.1 | hypothetical protein | - |
| IB938_RS04555 (IB938_04555) | - | 860257..861030 (+) | 774 | WP_011528569.1 | hypothetical protein | - |
| IB938_RS04560 (IB938_04560) | - | 861040..861261 (+) | 222 | WP_009880241.1 | hypothetical protein | - |
| IB938_RS04565 (IB938_04565) | - | 861261..861920 (+) | 660 | WP_011528570.1 | hypothetical protein | - |
| IB938_RS04570 (IB938_04570) | - | 861989..862423 (-) | 435 | WP_011017966.1 | hypothetical protein | - |
| IB938_RS04575 (IB938_04575) | sda3 | 862695..863495 (-) | 801 | WP_011285611.1 | streptodornase Sda3 | - |
| IB938_RS04580 (IB938_04580) | prx | 863733..863921 (+) | 189 | WP_011528571.1 | hypothetical protein | Regulator |
Sequence
Protein
Download Length: 62 a.a. Molecular weight: 7224.11 Da Isoelectric Point: 4.0606
>NTDB_id=480819 IB938_RS04580 WP_011528571.1 863733..863921(+) (prx) [Streptococcus pyogenes strain BSAC_bs1802 isolate Invasive disease]
MLTYDEFKQAIDREYITGDTVMIVRKNGQIFDYVLPHEEVRNGEVVTIERISDVMAELSESE
MLTYDEFKQAIDREYITGDTVMIVRKNGQIFDYVLPHEEVRNGEVVTIERISDVMAELSESE
Nucleotide
Download Length: 189 bp
>NTDB_id=480819 IB938_RS04580 WP_011528571.1 863733..863921(+) (prx) [Streptococcus pyogenes strain BSAC_bs1802 isolate Invasive disease]
ATGCTAACATATGACGAGTTTAAGCAAGCAATCGACCGTGAATATATCACAGGAGACACAGTTATGATCGTGCGCAAGAA
CGGACAGATTTTTGATTATGTGTTGCCGCATGAAGAAGTGAGAAATGGGGAAGTTGTGACAATCGAGCGGATATCAGATG
TTATGGCAGAACTTTCTGAGTCTGAATAA
ATGCTAACATATGACGAGTTTAAGCAAGCAATCGACCGTGAATATATCACAGGAGACACAGTTATGATCGTGCGCAAGAA
CGGACAGATTTTTGATTATGTGTTGCCGCATGAAGAAGTGAGAAATGGGGAAGTTGTGACAATCGAGCGGATATCAGATG
TTATGGCAGAACTTTCTGAGTCTGAATAA
Domains
No domain identified.
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS315 |
76.667 |
96.774 |
0.742 |
| prx | Streptococcus pyogenes MGAS315 |
76.271 |
95.161 |
0.726 |
| prx | Streptococcus pyogenes MGAS8232 |
76.271 |
95.161 |
0.726 |
| prx | Streptococcus pyogenes MGAS315 |
71.667 |
96.774 |
0.694 |
| prx | Streptococcus pyogenes MGAS315 |
90.698 |
69.355 |
0.629 |
| prx | Streptococcus pyogenes MGAS315 |
85.366 |
66.129 |
0.565 |
| prx | Streptococcus pyogenes MGAS315 |
76.19 |
67.742 |
0.516 |