Detailed information
Overview
| Name | prx | Type | Regulator |
| Locus tag | H7786_RS05965 | Genome accession | NZ_CP060649 |
| Coordinates | 1201395..1201577 (-) | Length | 60 a.a. |
| NCBI ID | WP_011184726.1 | Uniprot ID | - |
| Organism | Streptococcus pyogenes strain TSPY270 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1201395..1233378 | 1201395..1201577 | within | 0 |
Gene organization within MGE regions
Location: 1201395..1233378
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| H7786_RS05965 (H7786_06025) | prx | 1201395..1201577 (-) | 183 | WP_011184726.1 | hypothetical protein | Regulator |
| H7786_RS05970 (H7786_06030) | mf2 | 1201817..1202575 (+) | 759 | WP_011184727.1 | DNase Mf2 | - |
| H7786_RS05975 (H7786_06035) | speC | 1202686..1203393 (+) | 708 | WP_002985327.1 | streptococcal pyrogenic exotoxin SpeC | - |
| H7786_RS05980 (H7786_06040) | - | 1203462..1204214 (-) | 753 | WP_030126404.1 | CHAP domain-containing protein | - |
| H7786_RS05985 (H7786_06045) | - | 1204332..1204787 (-) | 456 | WP_011184730.1 | phage holin family protein | - |
| H7786_RS05990 (H7786_06050) | - | 1204797..1205408 (-) | 612 | WP_011184731.1 | DUF1366 domain-containing protein | - |
| H7786_RS05995 (H7786_06055) | - | 1205411..1205839 (-) | 429 | WP_011184732.1 | DUF1617 family protein | - |
| H7786_RS06000 (H7786_06060) | - | 1205848..1207629 (-) | 1782 | WP_011184733.1 | gp58-like family protein | - |
| H7786_RS06005 (H7786_06065) | - | 1207644..1208753 (-) | 1110 | WP_011184734.1 | hyaluronoglucosaminidase | - |
| H7786_RS06010 (H7786_06070) | - | 1208753..1210726 (-) | 1974 | WP_011054676.1 | phage tail spike protein | - |
| H7786_RS06015 (H7786_06075) | - | 1210708..1211403 (-) | 696 | WP_002992579.1 | hypothetical protein | - |
| H7786_RS06020 (H7786_06080) | - | 1211400..1213763 (-) | 2364 | WP_030126402.1 | hypothetical protein | - |
| H7786_RS06025 (H7786_06085) | - | 1213763..1214134 (-) | 372 | WP_011054678.1 | DUF5361 domain-containing protein | - |
| H7786_RS06030 (H7786_06090) | - | 1214149..1214412 (-) | 264 | WP_010922455.1 | hypothetical protein | - |
| H7786_RS06035 (H7786_06095) | - | 1214423..1215013 (-) | 591 | WP_011054679.1 | hypothetical protein | - |
| H7786_RS06040 (H7786_06100) | - | 1215029..1215364 (-) | 336 | WP_000573598.1 | hypothetical protein | - |
| H7786_RS06045 (H7786_06105) | - | 1215365..1215601 (-) | 237 | WP_000032787.1 | hypothetical protein | - |
| H7786_RS06050 (H7786_06110) | - | 1215594..1215932 (-) | 339 | WP_011054681.1 | hypothetical protein | - |
| H7786_RS06055 (H7786_06115) | - | 1215892..1216314 (-) | 423 | WP_011054682.1 | phage Gp19/Gp15/Gp42 family protein | - |
| H7786_RS06060 (H7786_06120) | - | 1216324..1216524 (-) | 201 | WP_010922460.1 | hypothetical protein | - |
| H7786_RS06065 (H7786_06125) | - | 1216524..1217435 (-) | 912 | WP_011054683.1 | phage major capsid protein | - |
| H7786_RS06070 (H7786_06130) | - | 1217460..1217921 (-) | 462 | WP_010922462.1 | DUF4355 domain-containing protein | - |
| H7786_RS06075 (H7786_06135) | - | 1218002..1219417 (-) | 1416 | WP_011054685.1 | terminase | - |
| H7786_RS06080 (H7786_06140) | - | 1219499..1219714 (-) | 216 | WP_011106704.1 | hypothetical protein | - |
| H7786_RS06085 (H7786_06145) | - | 1219716..1219982 (-) | 267 | WP_002986828.1 | hypothetical protein | - |
| H7786_RS06090 (H7786_06150) | - | 1219975..1220127 (-) | 153 | WP_011054687.1 | hypothetical protein | - |
| H7786_RS06095 (H7786_06155) | - | 1220204..1220428 (-) | 225 | WP_002994100.1 | hypothetical protein | - |
| H7786_RS06100 (H7786_06160) | - | 1220434..1221927 (-) | 1494 | WP_010922467.1 | hypothetical protein | - |
| H7786_RS06105 (H7786_06165) | - | 1221920..1223188 (-) | 1269 | WP_010922468.1 | phage portal protein | - |
| H7786_RS06110 (H7786_06170) | - | 1223185..1223541 (-) | 357 | WP_002994106.1 | hypothetical protein | - |
| H7786_RS06115 (H7786_06175) | - | 1223689..1224033 (-) | 345 | WP_030126400.1 | HNH endonuclease signature motif containing protein | - |
| H7786_RS06120 (H7786_06180) | - | 1224141..1224560 (-) | 420 | WP_030126399.1 | DUF1492 domain-containing protein | - |
| H7786_RS06125 (H7786_06185) | - | 1224636..1224887 (-) | 252 | WP_011054692.1 | hypothetical protein | - |
| H7786_RS06130 (H7786_06190) | - | 1224884..1225039 (-) | 156 | WP_011054693.1 | hypothetical protein | - |
| H7786_RS06135 (H7786_06195) | - | 1225036..1225353 (-) | 318 | WP_011054694.1 | DUF1372 family protein | - |
| H7786_RS06140 (H7786_06200) | - | 1225389..1225901 (-) | 513 | WP_011054695.1 | hypothetical protein | - |
| H7786_RS06145 (H7786_06205) | - | 1225898..1226230 (-) | 333 | WP_011184741.1 | hypothetical protein | - |
| H7786_RS06150 (H7786_06210) | - | 1226241..1226594 (-) | 354 | WP_228646659.1 | PcfJ domain-containing protein | - |
| H7786_RS06155 (H7786_06215) | - | 1226653..1226886 (-) | 234 | WP_002988350.1 | hypothetical protein | - |
| H7786_RS06160 (H7786_06220) | - | 1226867..1227253 (-) | 387 | WP_002990076.1 | DnaD domain-containing protein | - |
| H7786_RS06165 | - | 1227394..1227663 (-) | 270 | WP_011106700.1 | replication protein | - |
| H7786_RS06170 (H7786_06225) | - | 1227757..1227942 (-) | 186 | WP_010922477.1 | hypothetical protein | - |
| H7786_RS06175 (H7786_06230) | - | 1227944..1228255 (-) | 312 | WP_010922478.1 | excisionase | - |
| H7786_RS06180 (H7786_06235) | - | 1228525..1228737 (-) | 213 | WP_010922479.1 | helix-turn-helix domain-containing protein | - |
| H7786_RS06185 (H7786_06240) | - | 1228939..1229694 (+) | 756 | WP_010922480.1 | helix-turn-helix domain-containing protein | - |
| H7786_RS06190 (H7786_06245) | - | 1229706..1230224 (+) | 519 | WP_010922481.1 | HIRAN domain-containing protein | - |
| H7786_RS06195 (H7786_06250) | - | 1230348..1231490 (+) | 1143 | WP_003051793.1 | tyrosine-type recombinase/integrase | - |
| H7786_RS06200 (H7786_06255) | - | 1231579..1231854 (-) | 276 | WP_002983920.1 | HU family DNA-binding protein | - |
| H7786_RS06205 (H7786_06260) | - | 1231953..1232540 (-) | 588 | WP_002989129.1 | YpmS family protein | - |
| H7786_RS06210 (H7786_06265) | - | 1232518..1233360 (-) | 843 | WP_228646580.1 | SGNH/GDSL hydrolase family protein | - |
Sequence
Protein
Download Length: 60 a.a. Molecular weight: 6936.91 Da Isoelectric Point: 4.1954
>NTDB_id=477536 H7786_RS05965 WP_011184726.1 1201395..1201577(-) (prx) [Streptococcus pyogenes strain TSPY270]
MLTYDEFKQAIDNGYITADTVMIVRKNGQIFDYVLPNEKIKNGEIVTDEKVEEVLVELSR
MLTYDEFKQAIDNGYITADTVMIVRKNGQIFDYVLPNEKIKNGEIVTDEKVEEVLVELSR
Nucleotide
Download Length: 183 bp
>NTDB_id=477536 H7786_RS05965 WP_011184726.1 1201395..1201577(-) (prx) [Streptococcus pyogenes strain TSPY270]
ATGCTAACATACGACGAATTTAAACAAGCAATTGACAATGGATATATCACAGCAGACACAGTAATGATCGTGCGCAAGAA
CGGACAGATTTTTGATTATGTGTTGCCGAATGAGAAGATAAAGAATGGAGAAATTGTGACAGACGAAAAAGTGGAAGAGG
TGCTGGTGGAGCTTTCGAGATAA
ATGCTAACATACGACGAATTTAAACAAGCAATTGACAATGGATATATCACAGCAGACACAGTAATGATCGTGCGCAAGAA
CGGACAGATTTTTGATTATGTGTTGCCGAATGAGAAGATAAAGAATGGAGAAATTGTGACAGACGAAAAAGTGGAAGAGG
TGCTGGTGGAGCTTTCGAGATAA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS315 |
98.333 |
100 |
0.983 |
| prx | Streptococcus pyogenes MGAS8232 |
86.667 |
100 |
0.867 |
| prx | Streptococcus pyogenes MGAS315 |
78.333 |
100 |
0.783 |
| prx | Streptococcus pyogenes MGAS315 |
75 |
100 |
0.75 |
| prx | Streptococcus pyogenes MGAS315 |
83.721 |
71.667 |
0.6 |
| prx | Streptococcus pyogenes MGAS315 |
85.366 |
68.333 |
0.583 |
| prx | Streptococcus pyogenes MGAS315 |
71.429 |
70 |
0.5 |