Detailed information
Bioinformatically predicted
Overview
| Name | prx | Type | Regulator |
| Locus tag | H7786_RS03310 | Genome accession | NZ_CP060649 |
| Coordinates | 631122..631301 (+) | Length | 59 a.a. |
| NCBI ID | WP_030126037.1 | Uniprot ID | - |
| Organism | Streptococcus pyogenes strain TSPY270 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 587239..634645 | 631122..631301 | within | 0 |
Gene organization within MGE regions
Location: 587239..634645
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| H7786_RS03045 (H7786_03085) | ftsE | 588238..588930 (+) | 693 | WP_002985455.1 | cell division ATP-binding protein FtsE | - |
| H7786_RS03050 (H7786_03090) | ftsX | 588923..589852 (+) | 930 | WP_002990498.1 | permease-like cell division protein FtsX | - |
| H7786_RS03055 (H7786_03095) | - | 590162..590797 (-) | 636 | WP_002985449.1 | MBL fold metallo-hydrolase | - |
| H7786_RS03060 (H7786_03100) | - | 591028..591792 (+) | 765 | WP_002993974.1 | (S)-acetoin forming diacetyl reductase | - |
| H7786_RS03065 (H7786_03105) | - | 591942..594401 (+) | 2460 | WP_032465485.1 | bifunctional DnaQ family exonuclease/ATP-dependent helicase | - |
| H7786_RS03070 (H7786_03110) | - | 594736..595929 (+) | 1194 | WP_002985439.1 | pyridoxal phosphate-dependent aminotransferase | - |
| H7786_RS03075 (H7786_03115) | asnS | 595950..597296 (+) | 1347 | WP_002985437.1 | asparagine--tRNA ligase | - |
| H7786_RS03080 (H7786_03120) | rapZ | 597710..598600 (+) | 891 | WP_002985434.1 | RNase adapter RapZ | - |
| H7786_RS03085 (H7786_03125) | - | 598597..599574 (+) | 978 | WP_011017561.1 | YvcK family protein | - |
| H7786_RS03090 (H7786_03130) | whiA | 599571..600482 (+) | 912 | WP_011054317.1 | DNA-binding protein WhiA | - |
| H7786_RS03095 (H7786_03135) | - | 600616..602013 (+) | 1398 | WP_030126061.1 | C69 family dipeptidase | - |
| H7786_RS03100 (H7786_03140) | - | 602165..603712 (+) | 1548 | WP_030126060.1 | zinc ABC transporter substrate-binding protein AdcA | - |
| H7786_RS03105 (H7786_03145) | - | 603859..604581 (+) | 723 | WP_030126059.1 | GntR family transcriptional regulator | - |
| H7786_RS03110 (H7786_03150) | - | 604600..605799 (+) | 1200 | WP_030126058.1 | SIS domain-containing protein | - |
| H7786_RS03115 (H7786_03155) | - | 605896..606156 (-) | 261 | WP_002985307.1 | type B 50S ribosomal protein L31 | - |
| H7786_RS03120 (H7786_03160) | - | 606271..607212 (-) | 942 | WP_011528442.1 | DHH family phosphoesterase | - |
| H7786_RS03125 (H7786_03165) | - | 607606..608055 (+) | 450 | WP_002985303.1 | flavodoxin | - |
| H7786_RS03130 (H7786_03170) | - | 608231..608515 (+) | 285 | WP_030126057.1 | chorismate mutase | - |
| H7786_RS03135 (H7786_03175) | - | 608508..609770 (+) | 1263 | WP_030126056.1 | voltage-gated chloride channel family protein | - |
| H7786_RS03140 (H7786_03180) | rplS | 609885..610232 (+) | 348 | WP_002985298.1 | 50S ribosomal protein L19 | - |
| H7786_RS03150 (H7786_03190) | - | 610596..611683 (-) | 1088 | Protein_582 | tyrosine-type recombinase/integrase | - |
| H7786_RS03155 (H7786_03195) | - | 611802..612323 (-) | 522 | WP_023612337.1 | hypothetical protein | - |
| H7786_RS03160 (H7786_03200) | - | 612334..612711 (-) | 378 | WP_030126053.1 | ImmA/IrrE family metallo-endopeptidase | - |
| H7786_RS03165 (H7786_03205) | - | 612695..613054 (-) | 360 | WP_023611288.1 | helix-turn-helix domain-containing protein | - |
| H7786_RS03170 (H7786_03210) | - | 613242..613460 (+) | 219 | WP_023612341.1 | helix-turn-helix domain-containing protein | - |
| H7786_RS03175 (H7786_03215) | - | 613560..613790 (+) | 231 | WP_023612302.1 | hypothetical protein | - |
| H7786_RS03180 (H7786_03220) | - | 613774..613917 (+) | 144 | WP_164492191.1 | hypothetical protein | - |
| H7786_RS03185 (H7786_03225) | - | 613927..614145 (+) | 219 | WP_023612348.1 | hypothetical protein | - |
| H7786_RS03190 (H7786_03230) | - | 614147..614389 (+) | 243 | WP_003056170.1 | hypothetical protein | - |
| H7786_RS03195 (H7786_03235) | - | 614373..615692 (+) | 1320 | WP_030126052.1 | AAA family ATPase | - |
| H7786_RS03200 (H7786_03240) | - | 615707..616801 (+) | 1095 | WP_030126051.1 | ATP-binding protein | - |
| H7786_RS03205 (H7786_03245) | - | 616909..617424 (+) | 516 | Protein_593 | hypothetical protein | - |
| H7786_RS03210 (H7786_03250) | - | 617446..618081 (+) | 636 | WP_030126049.1 | hypothetical protein | - |
| H7786_RS03215 (H7786_03255) | - | 618081..619412 (+) | 1332 | WP_030126048.1 | DEAD/DEAH box helicase | - |
| H7786_RS03220 (H7786_03260) | - | 619422..619925 (+) | 504 | WP_228646645.1 | hypothetical protein | - |
| H7786_RS03225 (H7786_03265) | - | 620041..622302 (+) | 2262 | WP_030126047.1 | AAA family ATPase | - |
| H7786_RS03230 (H7786_03270) | - | 622681..622914 (+) | 234 | WP_030126046.1 | crAss001_48 related protein | - |
| H7786_RS03235 (H7786_03275) | - | 622904..623302 (+) | 399 | WP_030126045.1 | RusA family crossover junction endodeoxyribonuclease | - |
| H7786_RS03240 (H7786_03280) | - | 623299..623523 (+) | 225 | WP_030126044.1 | hypothetical protein | - |
| H7786_RS03245 (H7786_03285) | - | 623526..623699 (+) | 174 | WP_200868818.1 | hypothetical protein | - |
| H7786_RS03250 (H7786_03290) | - | 623708..623992 (+) | 285 | WP_011018137.1 | DUF3310 domain-containing protein | - |
| H7786_RS03255 (H7786_03295) | - | 623989..624402 (+) | 414 | WP_030126043.1 | YopX family protein | - |
| H7786_RS03260 (H7786_03300) | - | 624399..624683 (+) | 285 | WP_030126042.1 | hypothetical protein | - |
| H7786_RS03265 (H7786_03305) | - | 624687..625172 (+) | 486 | WP_228646647.1 | class I SAM-dependent methyltransferase | - |
| H7786_RS03270 (H7786_03310) | - | 625174..625812 (+) | 639 | WP_030126040.1 | N-6 DNA methylase | - |
| H7786_RS03275 (H7786_03315) | - | 626185..626622 (+) | 438 | WP_021340586.1 | DUF1492 domain-containing protein | - |
| H7786_RS03280 (H7786_03320) | terS | 627227..627940 (+) | 714 | WP_030126039.1 | phage terminase small subunit | - |
| H7786_RS03285 (H7786_03325) | - | 627943..628185 (+) | 243 | Protein_609 | PBSX family phage terminase large subunit | - |
| H7786_RS03290 (H7786_03330) | - | 628174..628572 (+) | 399 | Protein_610 | SH3 domain-containing protein | - |
| H7786_RS03295 (H7786_03335) | - | 628937..629449 (+) | 513 | WP_012767010.1 | PBECR4 domain-containing protein | - |
| H7786_RS03300 (H7786_03340) | - | 629638..629838 (+) | 201 | WP_011888781.1 | CsbD family protein | - |
| H7786_RS03305 (H7786_03345) | - | 629900..630889 (-) | 990 | WP_050443212.1 | DNA/RNA non-specific endonuclease | - |
| H7786_RS03310 (H7786_03350) | prx | 631122..631301 (+) | 180 | WP_030126037.1 | hypothetical protein | Regulator |
| H7786_RS09150 (H7786_03355) | - | 631479..631754 (-) | 276 | Protein_615 | tyrosine-type recombinase/integrase | - |
| H7786_RS03320 | - | 631759..632029 (+) | 271 | Protein_616 | rod shape-determining protein RodA | - |
| H7786_RS03325 (H7786_03360) | - | 632132..632692 (+) | 561 | WP_002990461.1 | HAD-IA family hydrolase | - |
| H7786_RS03330 (H7786_03365) | gyrB | 632693..634645 (+) | 1953 | WP_002994058.1 | DNA topoisomerase (ATP-hydrolyzing) subunit B | - |
Sequence
Protein
Download Length: 59 a.a. Molecular weight: 6883.90 Da Isoelectric Point: 4.3010
>NTDB_id=477528 H7786_RS03310 WP_030126037.1 631122..631301(+) (prx) [Streptococcus pyogenes strain TSPY270]
MLTYDEFKQAIDDGYITGHTVAIVRKNGQIFDYALPGEKVRPWEVVIEERVAEVLMELW
MLTYDEFKQAIDDGYITGHTVAIVRKNGQIFDYALPGEKVRPWEVVIEERVAEVLMELW
Nucleotide
Download Length: 180 bp
>NTDB_id=477528 H7786_RS03310 WP_030126037.1 631122..631301(+) (prx) [Streptococcus pyogenes strain TSPY270]
ATGCTAACATACGATGAGTTTAAGCAAGCTATTGATGACGGATATATCACAGGACACACAGTGGCGATCGTGCGCAAAAA
CGGACAGATTTTTGATTATGCGTTGCCTGGTGAGAAAGTCAGACCATGGGAGGTTGTGATCGAGGAGAGGGTGGCGGAGG
TGTTGATGGAATTGTGGTGA
ATGCTAACATACGATGAGTTTAAGCAAGCTATTGATGACGGATATATCACAGGACACACAGTGGCGATCGTGCGCAAAAA
CGGACAGATTTTTGATTATGCGTTGCCTGGTGAGAAAGTCAGACCATGGGAGGTTGTGATCGAGGAGAGGGTGGCGGAGG
TGTTGATGGAATTGTGGTGA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS315 |
82.759 |
98.305 |
0.814 |
| prx | Streptococcus pyogenes MGAS315 |
79.31 |
98.305 |
0.78 |
| prx | Streptococcus pyogenes MGAS8232 |
75.862 |
98.305 |
0.746 |
| prx | Streptococcus pyogenes MGAS315 |
72.414 |
98.305 |
0.712 |
| prx | Streptococcus pyogenes MGAS315 |
90.476 |
71.186 |
0.644 |
| prx | Streptococcus pyogenes MGAS315 |
82.927 |
69.492 |
0.576 |
| prx | Streptococcus pyogenes MGAS315 |
78.049 |
69.492 |
0.542 |