Detailed information
Overview
| Name | prx | Type | Regulator |
| Locus tag | H7787_RS06935 | Genome accession | NZ_CP060648 |
| Coordinates | 1381159..1381338 (-) | Length | 59 a.a. |
| NCBI ID | WP_002988813.1 | Uniprot ID | Q5YAB1 |
| Organism | Streptococcus pyogenes strain TSPY383 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1381159..1421776 | 1381159..1381338 | within | 0 |
Gene organization within MGE regions
Location: 1381159..1421776
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| H7787_RS06935 (H7787_06920) | prx | 1381159..1381338 (-) | 180 | WP_002988813.1 | hypothetical protein | Regulator |
| H7787_RS06940 (H7787_06925) | sda1 | 1381577..1382749 (+) | 1173 | WP_002988811.1 | streptodornase Sda1 | - |
| H7787_RS06945 (H7787_06930) | - | 1382865..1384061 (-) | 1197 | WP_002988807.1 | glucosaminidase domain-containing protein | - |
| H7787_RS06950 (H7787_06935) | - | 1384172..1384357 (-) | 186 | WP_002988802.1 | holin | - |
| H7787_RS06955 (H7787_06940) | - | 1384354..1384653 (-) | 300 | WP_002988799.1 | hypothetical protein | - |
| H7787_RS06960 (H7787_06945) | - | 1384664..1385284 (-) | 621 | WP_002988797.1 | hypothetical protein | - |
| H7787_RS06965 (H7787_06950) | - | 1385287..1385448 (-) | 162 | WP_002988795.1 | hypothetical protein | - |
| H7787_RS06970 (H7787_06955) | - | 1385457..1387364 (-) | 1908 | WP_002988792.1 | gp58-like family protein | - |
| H7787_RS06975 (H7787_06960) | - | 1387375..1388010 (-) | 636 | WP_002988442.1 | hypothetical protein | - |
| H7787_RS06980 (H7787_06965) | - | 1388010..1389065 (-) | 1056 | WP_002988439.1 | hypothetical protein | - |
| H7787_RS06985 (H7787_06970) | - | 1389062..1391044 (-) | 1983 | WP_002988790.1 | phage tail protein | - |
| H7787_RS06990 (H7787_06975) | - | 1391054..1391896 (-) | 843 | WP_002988788.1 | phage tail family protein | - |
| H7787_RS06995 (H7787_06980) | - | 1391908..1396290 (-) | 4383 | WP_002988786.1 | tape measure protein | - |
| H7787_RS07000 (H7787_06985) | - | 1396305..1396538 (-) | 234 | WP_002983445.1 | hypothetical protein | - |
| H7787_RS07005 (H7787_06990) | - | 1396613..1397068 (-) | 456 | WP_002983443.1 | tail assembly chaperone | - |
| H7787_RS07010 (H7787_06995) | - | 1397122..1397721 (-) | 600 | WP_002988784.1 | phage major tail protein, TP901-1 family | - |
| H7787_RS07015 (H7787_07000) | - | 1397733..1398092 (-) | 360 | WP_002988782.1 | hypothetical protein | - |
| H7787_RS07020 (H7787_07005) | - | 1398096..1398440 (-) | 345 | WP_002988781.1 | HK97-gp10 family putative phage morphogenesis protein | - |
| H7787_RS07025 (H7787_07010) | - | 1398437..1398715 (-) | 279 | WP_000639437.1 | hypothetical protein | - |
| H7787_RS07030 (H7787_07015) | - | 1398726..1399082 (-) | 357 | WP_002988776.1 | phage head-tail connector protein | - |
| H7787_RS07035 (H7787_07020) | - | 1399094..1399981 (-) | 888 | WP_002988771.1 | hypothetical protein | - |
| H7787_RS07040 (H7787_07025) | - | 1399994..1400563 (-) | 570 | WP_002988768.1 | DUF4355 domain-containing protein | - |
| H7787_RS07045 (H7787_07030) | - | 1400719..1400985 (-) | 267 | WP_002988765.1 | hypothetical protein | - |
| H7787_RS07050 (H7787_07035) | - | 1400988..1401176 (-) | 189 | WP_002983423.1 | hypothetical protein | - |
| H7787_RS07055 (H7787_07040) | - | 1401207..1402652 (-) | 1446 | WP_015446273.1 | minor capsid protein | - |
| H7787_RS07060 (H7787_07045) | - | 1402612..1404144 (-) | 1533 | WP_002988758.1 | phage portal protein | - |
| H7787_RS07065 (H7787_07050) | - | 1404160..1405437 (-) | 1278 | WP_002988754.1 | PBSX family phage terminase large subunit | - |
| H7787_RS07070 (H7787_07055) | - | 1405427..1405879 (-) | 453 | WP_011106637.1 | terminase small subunit | - |
| H7787_RS07075 (H7787_07060) | - | 1405969..1406385 (-) | 417 | WP_002988747.1 | DUF722 domain-containing protein | - |
| H7787_RS07080 (H7787_07065) | - | 1406723..1407415 (-) | 693 | WP_102218684.1 | DNA-methyltransferase | - |
| H7787_RS07085 (H7787_07070) | - | 1407424..1407690 (-) | 267 | WP_002988738.1 | hypothetical protein | - |
| H7787_RS07090 (H7787_07075) | - | 1407687..1407854 (-) | 168 | WP_002988735.1 | hypothetical protein | - |
| H7787_RS07095 (H7787_07080) | - | 1407855..1409177 (-) | 1323 | WP_002988733.1 | SNF2-related protein | - |
| H7787_RS07100 (H7787_07085) | - | 1409174..1409449 (-) | 276 | WP_002988730.1 | VRR-NUC domain-containing protein | - |
| H7787_RS07105 (H7787_07090) | - | 1409836..1412220 (-) | 2385 | WP_011285674.1 | phage/plasmid primase, P4 family | - |
| H7787_RS07110 (H7787_07095) | - | 1412225..1414147 (-) | 1923 | WP_002988723.1 | DNA polymerase | - |
| H7787_RS07115 (H7787_07100) | - | 1414190..1414747 (-) | 558 | WP_002988718.1 | DUF2815 family protein | - |
| H7787_RS07120 (H7787_07105) | - | 1414758..1415156 (-) | 399 | WP_002988715.1 | hypothetical protein | - |
| H7787_RS07125 (H7787_07110) | - | 1415160..1416314 (-) | 1155 | WP_002988711.1 | DUF2800 domain-containing protein | - |
| H7787_RS07130 (H7787_07115) | - | 1416314..1416613 (-) | 300 | WP_002988708.1 | hypothetical protein | - |
| H7787_RS07135 (H7787_07120) | - | 1416701..1416904 (-) | 204 | WP_002988705.1 | hypothetical protein | - |
| H7787_RS07140 (H7787_07125) | - | 1417050..1417436 (-) | 387 | WP_002988700.1 | hypothetical protein | - |
| H7787_RS07145 (H7787_07130) | - | 1417433..1417636 (-) | 204 | WP_002988697.1 | hypothetical protein | - |
| H7787_RS07150 (H7787_07135) | - | 1417629..1417799 (-) | 171 | WP_002988693.1 | hypothetical protein | - |
| H7787_RS07155 (H7787_07140) | - | 1417796..1418071 (-) | 276 | WP_002988687.1 | hypothetical protein | - |
| H7787_RS07160 (H7787_07145) | - | 1418133..1418348 (-) | 216 | WP_002988684.1 | hypothetical protein | - |
| H7787_RS07165 (H7787_07150) | - | 1418396..1418809 (+) | 414 | WP_002988681.1 | hypothetical protein | - |
| H7787_RS07170 (H7787_07155) | - | 1418790..1418945 (-) | 156 | WP_002988678.1 | hypothetical protein | - |
| H7787_RS07175 (H7787_07160) | - | 1419271..1419621 (+) | 351 | WP_002988676.1 | helix-turn-helix domain-containing protein | - |
| H7787_RS07180 (H7787_07165) | - | 1419635..1420018 (+) | 384 | WP_002988673.1 | ImmA/IrrE family metallo-endopeptidase | - |
| H7787_RS07185 (H7787_07170) | - | 1420029..1420580 (+) | 552 | WP_002988670.1 | hypothetical protein | - |
| H7787_RS07190 (H7787_07175) | - | 1420697..1421776 (+) | 1080 | WP_002988667.1 | site-specific integrase | - |
Sequence
Protein
Download Length: 59 a.a. Molecular weight: 6798.70 Da Isoelectric Point: 4.2542
>NTDB_id=477480 H7787_RS06935 WP_002988813.1 1381159..1381338(-) (prx) [Streptococcus pyogenes strain TSPY383]
MLTYDEFKQAIDHGYITGDTVAIVRKNGQIFDYVLPHEKVKNGEVVTDEKVEEVLMELE
MLTYDEFKQAIDHGYITGDTVAIVRKNGQIFDYVLPHEKVKNGEVVTDEKVEEVLMELE
Nucleotide
Download Length: 180 bp
>NTDB_id=477480 H7787_RS06935 WP_002988813.1 1381159..1381338(-) (prx) [Streptococcus pyogenes strain TSPY383]
ATGCTAACATACGACGAATTTAAGCAAGCAATCGACCATGGGTATATCACAGGAGACACAGTAGCGATTGTGCGCAAAAA
CGGACAGATCTTTGATTATGTGTTGCCACATGAGAAAGTAAAGAATGGAGAAGTTGTGACAGATGAAAAAGTGGAAGAAG
TGTTGATGGAATTGGAGTAA
ATGCTAACATACGACGAATTTAAGCAAGCAATCGACCATGGGTATATCACAGGAGACACAGTAGCGATTGTGCGCAAAAA
CGGACAGATCTTTGATTATGTGTTGCCACATGAGAAAGTAAAGAATGGAGAAGTTGTGACAGATGAAAAAGTGGAAGAAG
TGTTGATGGAATTGGAGTAA
Domains
No domain identified.
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS8232 |
91.379 |
98.305 |
0.898 |
| prx | Streptococcus pyogenes MGAS315 |
87.931 |
98.305 |
0.864 |
| prx | Streptococcus pyogenes MGAS315 |
84.746 |
100 |
0.847 |
| prx | Streptococcus pyogenes MGAS315 |
74.576 |
100 |
0.746 |
| prx | Streptococcus pyogenes MGAS315 |
86.047 |
72.881 |
0.627 |
| prx | Streptococcus pyogenes MGAS315 |
90.244 |
69.492 |
0.627 |
| prx | Streptococcus pyogenes MGAS315 |
80.952 |
71.186 |
0.576 |