Detailed information
Bioinformatically predicted
Overview
| Name | prx | Type | Regulator |
| Locus tag | H7787_RS05670 | Genome accession | NZ_CP060648 |
| Coordinates | 1141504..1141686 (-) | Length | 60 a.a. |
| NCBI ID | WP_011017964.1 | Uniprot ID | - |
| Organism | Streptococcus pyogenes strain TSPY383 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1141504..1176499 | 1141504..1141686 | within | 0 |
Gene organization within MGE regions
Location: 1141504..1176499
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| H7787_RS05670 (H7787_05655) | prx | 1141504..1141686 (-) | 183 | WP_011017964.1 | hypothetical protein | Regulator |
| H7787_RS05675 (H7787_05660) | sda3 | 1141925..1142725 (+) | 801 | WP_011285611.1 | streptodornase Sda3 | - |
| H7787_RS05680 (H7787_05665) | - | 1142996..1143430 (+) | 435 | WP_011017966.1 | hypothetical protein | - |
| H7787_RS05685 (H7787_05670) | - | 1143500..1144705 (-) | 1206 | WP_010922446.1 | glucosaminidase domain-containing protein | - |
| H7787_RS05690 (H7787_05675) | - | 1144821..1145048 (-) | 228 | WP_003058873.1 | phage holin | - |
| H7787_RS05695 (H7787_05680) | - | 1145045..1145320 (-) | 276 | WP_002987582.1 | hypothetical protein | - |
| H7787_RS05700 (H7787_05685) | - | 1145330..1145947 (-) | 618 | WP_011285613.1 | DUF1366 domain-containing protein | - |
| H7787_RS05705 (H7787_05690) | - | 1145944..1146381 (-) | 438 | WP_011285614.1 | DUF1617 family protein | - |
| H7787_RS05710 (H7787_05695) | - | 1146393..1148261 (-) | 1869 | WP_011285615.1 | gp58-like family protein | - |
| H7787_RS05715 (H7787_05700) | - | 1148258..1148953 (-) | 696 | WP_010922452.1 | hypothetical protein | - |
| H7787_RS05720 (H7787_05705) | - | 1148950..1151307 (-) | 2358 | WP_010922453.1 | hypothetical protein | - |
| H7787_RS05725 (H7787_05710) | - | 1151307..1151678 (-) | 372 | WP_010922454.1 | DUF5361 domain-containing protein | - |
| H7787_RS05730 (H7787_05715) | - | 1151693..1151956 (-) | 264 | WP_010922455.1 | hypothetical protein | - |
| H7787_RS05735 (H7787_05720) | - | 1151967..1152560 (-) | 594 | WP_010922456.1 | tail protein | - |
| H7787_RS05740 (H7787_05725) | - | 1152572..1152907 (-) | 336 | WP_011285616.1 | hypothetical protein | - |
| H7787_RS05745 (H7787_05730) | - | 1152908..1153144 (-) | 237 | WP_228652744.1 | hypothetical protein | - |
| H7787_RS05750 (H7787_05735) | - | 1153137..1153475 (-) | 339 | WP_011285617.1 | hypothetical protein | - |
| H7787_RS05755 (H7787_05740) | - | 1153435..1153857 (-) | 423 | WP_010922459.1 | phage Gp19/Gp15/Gp42 family protein | - |
| H7787_RS05760 (H7787_05745) | - | 1153867..1154067 (-) | 201 | WP_010922460.1 | hypothetical protein | - |
| H7787_RS05765 (H7787_05750) | - | 1154067..1154978 (-) | 912 | WP_010922461.1 | phage major capsid protein | - |
| H7787_RS05770 (H7787_05755) | - | 1155003..1155464 (-) | 462 | WP_011285618.1 | DUF4355 domain-containing protein | - |
| H7787_RS05775 (H7787_05760) | - | 1155545..1156960 (-) | 1416 | WP_011285619.1 | terminase | - |
| H7787_RS05780 (H7787_05765) | - | 1157070..1157336 (-) | 267 | WP_010922464.1 | hypothetical protein | - |
| H7787_RS05785 (H7787_05770) | - | 1157329..1157508 (-) | 180 | WP_015055972.1 | hypothetical protein | - |
| H7787_RS05790 (H7787_05775) | - | 1157558..1157782 (-) | 225 | WP_010922466.1 | hypothetical protein | - |
| H7787_RS05795 (H7787_05780) | - | 1157788..1159281 (-) | 1494 | WP_015446231.1 | hypothetical protein | - |
| H7787_RS05800 (H7787_05785) | - | 1159274..1160542 (-) | 1269 | WP_010922468.1 | phage portal protein | - |
| H7787_RS05805 (H7787_05790) | - | 1160539..1160895 (-) | 357 | WP_002994106.1 | hypothetical protein | - |
| H7787_RS05810 (H7787_05795) | - | 1161044..1161388 (-) | 345 | WP_010922469.1 | HNH endonuclease signature motif containing protein | - |
| H7787_RS05815 (H7787_05800) | - | 1161497..1161916 (-) | 420 | WP_010922470.1 | DUF1492 domain-containing protein | - |
| H7787_RS05820 (H7787_05805) | - | 1162184..1162819 (-) | 636 | WP_010922070.1 | N-6 DNA methylase | - |
| H7787_RS05825 (H7787_05810) | - | 1162821..1163090 (-) | 270 | WP_002988369.1 | hypothetical protein | - |
| H7787_RS05830 (H7787_05815) | - | 1163174..1163686 (-) | 513 | WP_002988366.1 | hypothetical protein | - |
| H7787_RS05835 (H7787_05820) | - | 1163683..1164024 (-) | 342 | WP_002988364.1 | hypothetical protein | - |
| H7787_RS05840 (H7787_05825) | - | 1164202..1164369 (-) | 168 | WP_011285624.1 | hypothetical protein | - |
| H7787_RS05845 (H7787_05830) | - | 1164379..1165176 (-) | 798 | WP_011285625.1 | PD-(D/E)XK nuclease-like domain-containing protein | - |
| H7787_RS05850 (H7787_05835) | - | 1165173..1166102 (-) | 930 | WP_011285626.1 | recombinase RecT | - |
| H7787_RS05855 (H7787_05840) | - | 1166105..1166434 (-) | 330 | WP_002988359.1 | hypothetical protein | - |
| H7787_RS05860 (H7787_05845) | - | 1166490..1166696 (-) | 207 | WP_011017565.1 | hypothetical protein | - |
| H7787_RS05865 (H7787_05850) | - | 1166705..1166845 (-) | 141 | WP_011017992.1 | hypothetical protein | - |
| H7787_RS05870 (H7787_05855) | - | 1166842..1167075 (-) | 234 | WP_002985387.1 | hypothetical protein | - |
| H7787_RS05875 (H7787_05860) | - | 1167056..1167445 (-) | 390 | WP_011285627.1 | DnaD domain-containing protein | - |
| H7787_RS05880 | - | 1167575..1167814 (-) | 240 | WP_002985390.1 | hypothetical protein | - |
| H7787_RS05885 (H7787_05865) | - | 1167914..1168099 (-) | 186 | WP_011285628.1 | hypothetical protein | - |
| H7787_RS05890 (H7787_05870) | - | 1168101..1168412 (-) | 312 | WP_002990080.1 | hypothetical protein | - |
| H7787_RS05895 (H7787_05875) | - | 1168490..1168675 (-) | 186 | WP_011054585.1 | helix-turn-helix domain-containing protein | - |
| H7787_RS05900 (H7787_05880) | - | 1168842..1169081 (+) | 240 | WP_011284879.1 | hypothetical protein | - |
| H7787_RS05905 (H7787_05885) | - | 1169223..1170029 (+) | 807 | WP_011285629.1 | TIGR02391 family protein | - |
| H7787_RS05910 (H7787_05890) | - | 1169964..1170230 (-) | 267 | WP_010922204.1 | hypothetical protein | - |
| H7787_RS05915 (H7787_05895) | - | 1170262..1170978 (-) | 717 | WP_011285630.1 | phage antirepressor KilAC domain-containing protein | - |
| H7787_RS05920 (H7787_05900) | - | 1170990..1171181 (-) | 192 | WP_002993390.1 | hypothetical protein | - |
| H7787_RS05925 (H7787_05905) | - | 1171817..1171912 (+) | 96 | WP_020837421.1 | type I toxin-antitoxin system Fst family toxin | - |
| H7787_RS05930 (H7787_05910) | - | 1172335..1172682 (+) | 348 | WP_011285631.1 | helix-turn-helix domain-containing protein | - |
| H7787_RS05935 (H7787_05915) | - | 1172686..1173066 (+) | 381 | WP_002994744.1 | ImmA/IrrE family metallo-endopeptidase | - |
| H7787_RS05940 (H7787_05920) | - | 1173078..1173344 (+) | 267 | WP_011285632.1 | DUF4177 domain-containing protein | - |
| H7787_RS05945 (H7787_05925) | - | 1173468..1174610 (+) | 1143 | WP_003051793.1 | tyrosine-type recombinase/integrase | - |
| H7787_RS05950 (H7787_05930) | - | 1174700..1174975 (-) | 276 | WP_002983920.1 | HU family DNA-binding protein | - |
| H7787_RS05955 (H7787_05935) | - | 1175074..1175661 (-) | 588 | WP_010922482.1 | YpmS family protein | - |
| H7787_RS05960 (H7787_05940) | - | 1175639..1176481 (-) | 843 | WP_002992620.1 | SGNH/GDSL hydrolase family protein | - |
Sequence
Protein
Download Length: 60 a.a. Molecular weight: 6841.79 Da Isoelectric Point: 4.5183
>NTDB_id=477473 H7787_RS05670 WP_011017964.1 1141504..1141686(-) (prx) [Streptococcus pyogenes strain TSPY383]
MLTYDEFKQAIDNGYIAGDTVAIVRKDGQIFDYVLPHEKVKNGEVVTKEKVEEVLVELSR
MLTYDEFKQAIDNGYIAGDTVAIVRKDGQIFDYVLPHEKVKNGEVVTKEKVEEVLVELSR
Nucleotide
Download Length: 183 bp
>NTDB_id=477473 H7787_RS05670 WP_011017964.1 1141504..1141686(-) (prx) [Streptococcus pyogenes strain TSPY383]
ATGCTAACATACGACGAGTTTAAGCAAGCGATTGACAATGGATATATCGCAGGCGATACAGTAGCGATCGTGCGTAAAGA
CGGACAGATTTTTGATTATGTGTTGCCACATGAGAAAGTAAAGAATGGAGAAGTTGTGACTAAGGAAAAAGTGGAAGAGG
TGCTGGTGGAGCTTTCGAGATAA
ATGCTAACATACGACGAGTTTAAGCAAGCGATTGACAATGGATATATCGCAGGCGATACAGTAGCGATCGTGCGTAAAGA
CGGACAGATTTTTGATTATGTGTTGCCACATGAGAAAGTAAAGAATGGAGAAGTTGTGACTAAGGAAAAAGTGGAAGAGG
TGCTGGTGGAGCTTTCGAGATAA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS8232 |
100 |
100 |
1 |
| prx | Streptococcus pyogenes MGAS315 |
85 |
100 |
0.85 |
| prx | Streptococcus pyogenes MGAS315 |
80 |
100 |
0.8 |
| prx | Streptococcus pyogenes MGAS315 |
73.333 |
100 |
0.733 |
| prx | Streptococcus pyogenes MGAS315 |
90.244 |
68.333 |
0.617 |
| prx | Streptococcus pyogenes MGAS315 |
83.721 |
71.667 |
0.6 |
| prx | Streptococcus pyogenes MGAS315 |
78.571 |
70 |
0.55 |