Detailed information
Bioinformatically predicted
Overview
| Name | prx | Type | Regulator |
| Locus tag | H7787_RS04845 | Genome accession | NZ_CP060648 |
| Coordinates | 979763..979951 (-) | Length | 62 a.a. |
| NCBI ID | WP_011285559.1 | Uniprot ID | - |
| Organism | Streptococcus pyogenes strain TSPY383 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 972179..1018489 | 979763..979951 | within | 0 |
Gene organization within MGE regions
Location: 972179..1018489
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| H7787_RS04810 (H7787_04805) | pfkA | 972179..973192 (-) | 1014 | WP_010922375.1 | 6-phosphofructokinase | - |
| H7787_RS04815 (H7787_04810) | - | 973272..976382 (-) | 3111 | WP_010922376.1 | DNA polymerase III subunit alpha | - |
| H7787_RS04820 (H7787_04815) | - | 976567..976938 (+) | 372 | WP_010922377.1 | GntR family transcriptional regulator | - |
| H7787_RS04825 (H7787_04820) | - | 976938..977636 (+) | 699 | WP_002984437.1 | ABC transporter ATP-binding protein | - |
| H7787_RS04830 (H7787_04825) | - | 977646..978431 (+) | 786 | WP_010922378.1 | hypothetical protein | - |
| H7787_RS04835 (H7787_04830) | - | 978558..979172 (-) | 615 | WP_011285558.1 | TVP38/TMEM64 family protein | - |
| H7787_RS04845 (H7787_04840) | prx | 979763..979951 (-) | 189 | WP_011285559.1 | hypothetical protein | Regulator |
| H7787_RS04850 (H7787_04845) | speA | 980171..980926 (+) | 756 | WP_011285560.1 | streptococcal pyrogenic exotoxin SpeA | - |
| H7787_RS04855 (H7787_04850) | - | 981048..981707 (-) | 660 | WP_009880240.1 | hypothetical protein | - |
| H7787_RS04860 (H7787_04855) | - | 981707..981928 (-) | 222 | WP_009880241.1 | hypothetical protein | - |
| H7787_RS04865 (H7787_04860) | - | 981938..982711 (-) | 774 | WP_011054795.1 | hypothetical protein | - |
| H7787_RS04870 (H7787_04865) | - | 982722..983324 (-) | 603 | WP_011054796.1 | hypothetical protein | - |
| H7787_RS04875 (H7787_04870) | - | 983336..984100 (-) | 765 | WP_011285561.1 | CHAP domain-containing protein | - |
| H7787_RS04880 (H7787_04875) | - | 984102..984434 (-) | 333 | WP_011285562.1 | phage holin | - |
| H7787_RS04885 (H7787_04880) | - | 984434..984757 (-) | 324 | WP_015055952.1 | hypothetical protein | - |
| H7787_RS09080 | - | 984771..984893 (-) | 123 | WP_015055953.1 | hypothetical protein | - |
| H7787_RS04890 (H7787_04885) | - | 984907..985254 (-) | 348 | WP_011285564.1 | DUF1366 domain-containing protein | - |
| H7787_RS04895 (H7787_04890) | - | 985265..987127 (-) | 1863 | WP_015055954.1 | DUF859 family phage minor structural protein | - |
| H7787_RS04900 (H7787_04895) | - | 987132..990572 (-) | 3441 | WP_011285566.1 | glucosaminidase domain-containing protein | - |
| H7787_RS04905 (H7787_04900) | - | 990573..992057 (-) | 1485 | WP_009880250.1 | distal tail protein Dit | - |
| H7787_RS04910 (H7787_04905) | - | 992058..993863 (-) | 1806 | WP_011054802.1 | tail protein | - |
| H7787_RS04915 (H7787_04910) | - | 993856..994314 (-) | 459 | WP_009880253.1 | hypothetical protein | - |
| H7787_RS04920 (H7787_04915) | - | 994287..994604 (-) | 318 | WP_009880254.1 | hypothetical protein | - |
| H7787_RS04925 (H7787_04920) | - | 994617..995123 (-) | 507 | WP_009880255.1 | phage major tail protein, TP901-1 family | - |
| H7787_RS04930 (H7787_04925) | - | 995135..995545 (-) | 411 | WP_009880256.1 | DUF5072 family protein | - |
| H7787_RS04935 (H7787_04930) | - | 995547..995942 (-) | 396 | WP_009880257.1 | hypothetical protein | - |
| H7787_RS04940 (H7787_04935) | - | 995939..996250 (-) | 312 | WP_011285567.1 | hypothetical protein | - |
| H7787_RS04945 (H7787_04940) | - | 996247..996591 (-) | 345 | WP_009880259.1 | hypothetical protein | - |
| H7787_RS04950 (H7787_04945) | - | 996605..996898 (-) | 294 | WP_009880260.1 | HeH/LEM domain-containing protein | - |
| H7787_RS04955 (H7787_04950) | - | 996911..997801 (-) | 891 | WP_009880261.1 | hypothetical protein | - |
| H7787_RS04960 (H7787_04955) | - | 997820..998389 (-) | 570 | WP_009880262.1 | DUF4355 domain-containing protein | - |
| H7787_RS09085 | - | 998498..998632 (-) | 135 | WP_015055956.1 | hypothetical protein | - |
| H7787_RS04965 (H7787_04960) | - | 998634..998903 (-) | 270 | WP_011285568.1 | hypothetical protein | - |
| H7787_RS04970 (H7787_04965) | - | 998910..999818 (-) | 909 | WP_011285569.1 | minor capsid protein | - |
| H7787_RS04975 (H7787_04970) | - | 999787..1001112 (-) | 1326 | WP_011285570.1 | phage portal protein | - |
| H7787_RS04980 (H7787_04975) | - | 1001112..1002386 (-) | 1275 | WP_009880266.1 | PBSX family phage terminase large subunit | - |
| H7787_RS04985 (H7787_04980) | - | 1002376..1002756 (-) | 381 | WP_011285571.1 | hypothetical protein | - |
| H7787_RS04990 (H7787_04985) | - | 1003366..1003800 (-) | 435 | WP_011054810.1 | ArpU family phage packaging/lysis transcriptional regulator | - |
| H7787_RS04995 (H7787_04990) | - | 1004086..1004352 (-) | 267 | WP_011018131.1 | hypothetical protein | - |
| H7787_RS05000 (H7787_04995) | - | 1004349..1004873 (-) | 525 | WP_011285572.1 | DUF1642 domain-containing protein | - |
| H7787_RS05005 (H7787_05000) | - | 1004876..1005508 (-) | 633 | WP_011018133.1 | N-6 DNA methylase | - |
| H7787_RS05010 (H7787_05005) | - | 1005510..1005794 (-) | 285 | WP_011018134.1 | hypothetical protein | - |
| H7787_RS05015 (H7787_05010) | - | 1005791..1005961 (-) | 171 | WP_002995952.1 | hypothetical protein | - |
| H7787_RS05020 (H7787_05015) | - | 1005958..1006194 (-) | 237 | WP_002995955.1 | DUF3310 domain-containing protein | - |
| H7787_RS09130 | - | 1006194..1006439 (-) | 246 | WP_011285573.1 | hypothetical protein | - |
| H7787_RS05025 (H7787_05020) | - | 1006436..1006792 (-) | 357 | WP_011284873.1 | hypothetical protein | - |
| H7787_RS05030 (H7787_05025) | - | 1006789..1007229 (-) | 441 | WP_011285574.1 | RusA family crossover junction endodeoxyribonuclease | - |
| H7787_RS05035 (H7787_05030) | - | 1007229..1007432 (-) | 204 | WP_011106686.1 | hypothetical protein | - |
| H7787_RS05040 (H7787_05035) | ssb | 1007438..1007863 (-) | 426 | WP_011285575.1 | single-stranded DNA-binding protein | Machinery gene |
| H7787_RS05045 (H7787_05040) | - | 1007856..1008530 (-) | 675 | WP_011285576.1 | ERF family protein | - |
| H7787_RS05050 (H7787_05045) | - | 1008531..1009013 (-) | 483 | WP_011285577.1 | siphovirus Gp157 family protein | - |
| H7787_RS05055 (H7787_05050) | - | 1009035..1009289 (-) | 255 | WP_011285578.1 | hypothetical protein | - |
| H7787_RS05060 (H7787_05055) | - | 1009270..1009623 (-) | 354 | WP_011285579.1 | hypothetical protein | - |
| H7787_RS05065 (H7787_05060) | - | 1009764..1010546 (-) | 783 | WP_011285581.1 | ATP-binding protein | - |
| H7787_RS05070 (H7787_05065) | - | 1010533..1011363 (-) | 831 | WP_009881060.1 | phage replisome organizer N-terminal domain-containing protein | - |
| H7787_RS05075 | - | 1011377..1011565 (-) | 189 | Protein_984 | XRE family transcriptional regulator | - |
| H7787_RS05080 | - | 1011799..1012038 (+) | 240 | WP_227874181.1 | hypothetical protein | - |
| H7787_RS05085 (H7787_05075) | - | 1012169..1012378 (+) | 210 | WP_011017885.1 | hypothetical protein | - |
| H7787_RS05090 (H7787_05080) | - | 1012488..1012688 (-) | 201 | WP_002992770.1 | helix-turn-helix domain-containing protein | - |
| H7787_RS05095 (H7787_05085) | - | 1012762..1013148 (+) | 387 | WP_011054589.1 | hypothetical protein | - |
| H7787_RS05100 (H7787_05090) | - | 1013137..1013346 (-) | 210 | WP_011284881.1 | hypothetical protein | - |
| H7787_RS05105 (H7787_05095) | - | 1013400..1013999 (+) | 600 | WP_011284882.1 | hypothetical protein | - |
| H7787_RS05110 (H7787_05100) | - | 1014029..1014187 (-) | 159 | WP_011285583.1 | hypothetical protein | - |
| H7787_RS05115 (H7787_05105) | - | 1014544..1015368 (+) | 825 | WP_011285584.1 | XRE family transcriptional regulator | - |
| H7787_RS05120 (H7787_05110) | - | 1015404..1016297 (+) | 894 | WP_011285585.1 | P63C domain-containing protein | - |
| H7787_RS05125 (H7787_05115) | - | 1016418..1017506 (+) | 1089 | WP_011054595.1 | site-specific integrase | - |
| H7787_RS05130 (H7787_05120) | - | 1017869..1018489 (+) | 621 | WP_002989605.1 | DUF3862 domain-containing protein | - |
Sequence
Protein
Download Length: 62 a.a. Molecular weight: 7290.41 Da Isoelectric Point: 4.3313
>NTDB_id=477469 H7787_RS04845 WP_011285559.1 979763..979951(-) (prx) [Streptococcus pyogenes strain TSPY383]
MLYIDEFKEAIDKGYILGDTVAIVRKNGKIFDYVLPHEKVRDDEVVTVERVEEVMVELDYIK
MLYIDEFKEAIDKGYILGDTVAIVRKNGKIFDYVLPHEKVRDDEVVTVERVEEVMVELDYIK
Nucleotide
Download Length: 189 bp
>NTDB_id=477469 H7787_RS04845 WP_011285559.1 979763..979951(-) (prx) [Streptococcus pyogenes strain TSPY383]
ATGTTATATATAGATGAGTTTAAAGAAGCGATTGATAAGGGGTATATTTTAGGTGACACAGTAGCGATAGTGCGTAAAAA
CGGAAAGATATTTGATTATGTGTTACCACACGAAAAAGTGAGAGATGATGAAGTTGTGACGGTAGAGAGAGTGGAAGAAG
TGATGGTGGAATTAGACTATATCAAATGA
ATGTTATATATAGATGAGTTTAAAGAAGCGATTGATAAGGGGTATATTTTAGGTGACACAGTAGCGATAGTGCGTAAAAA
CGGAAAGATATTTGATTATGTGTTACCACACGAAAAAGTGAGAGATGATGAAGTTGTGACGGTAGAGAGAGTGGAAGAAG
TGATGGTGGAATTAGACTATATCAAATGA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS315 |
100 |
95.161 |
0.952 |
| prx | Streptococcus pyogenes MGAS315 |
79.032 |
100 |
0.79 |
| prx | Streptococcus pyogenes MGAS8232 |
76.271 |
95.161 |
0.726 |
| prx | Streptococcus pyogenes MGAS315 |
76.271 |
95.161 |
0.726 |
| prx | Streptococcus pyogenes MGAS315 |
74.576 |
95.161 |
0.71 |
| prx | Streptococcus pyogenes MGAS315 |
69.492 |
95.161 |
0.661 |
| prx | Streptococcus pyogenes MGAS315 |
82.927 |
66.129 |
0.548 |