Detailed information
Bioinformatically predicted
Overview
| Name | prx | Type | Regulator |
| Locus tag | H7788_RS05630 | Genome accession | NZ_CP060647 |
| Coordinates | 1128750..1128932 (-) | Length | 60 a.a. |
| NCBI ID | WP_011017964.1 | Uniprot ID | - |
| Organism | Streptococcus pyogenes strain TSPY136 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1128750..1171511 | 1128750..1128932 | within | 0 |
Gene organization within MGE regions
Location: 1128750..1171511
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| H7788_RS05630 (H7788_05630) | prx | 1128750..1128932 (-) | 183 | WP_011017964.1 | hypothetical protein | Regulator |
| H7788_RS05635 (H7788_05635) | entC3 | 1129045..1129827 (-) | 783 | WP_002988472.1 | enterotoxin type C3 EntC3 | - |
| H7788_RS05640 (H7788_05640) | - | 1130075..1131199 (-) | 1125 | WP_002988467.1 | Fic family protein | - |
| H7788_RS05645 (H7788_05645) | - | 1131335..1132552 (-) | 1218 | WP_032460576.1 | peptidoglycan amidohydrolase family protein | - |
| H7788_RS05650 (H7788_05650) | - | 1132671..1132898 (-) | 228 | WP_003058873.1 | phage holin | - |
| H7788_RS05655 (H7788_05655) | - | 1132895..1133170 (-) | 276 | WP_002987582.1 | hypothetical protein | - |
| H7788_RS05660 (H7788_05660) | - | 1133180..1133797 (-) | 618 | WP_030127708.1 | hypothetical protein | - |
| H7788_RS05665 (H7788_05665) | - | 1133800..1133961 (-) | 162 | WP_002988795.1 | hypothetical protein | - |
| H7788_RS05670 (H7788_05670) | - | 1133975..1135870 (-) | 1896 | WP_011284841.1 | gp58-like family protein | - |
| H7788_RS05675 (H7788_05675) | - | 1135881..1136195 (-) | 315 | WP_021340983.1 | hypothetical protein | - |
| H7788_RS05680 (H7788_05680) | - | 1136197..1137411 (-) | 1215 | WP_011284843.1 | hypothetical protein | - |
| H7788_RS08840 (H7788_05685) | - | 1137408..1139519 (-) | 2112 | WP_111705991.1 | phage tail spike protein | - |
| H7788_RS05695 (H7788_05690) | - | 1139516..1140286 (-) | 771 | WP_030127447.1 | distal tail protein Dit | - |
| H7788_RS05700 (H7788_05695) | - | 1140286..1143033 (-) | 2748 | WP_030127446.1 | phage tail tape measure protein | - |
| H7788_RS05705 (H7788_05700) | - | 1143033..1143350 (-) | 318 | WP_030127445.1 | hypothetical protein | - |
| H7788_RS05710 (H7788_05705) | - | 1143371..1143739 (-) | 369 | WP_030127444.1 | tail assembly chaperone | - |
| H7788_RS05715 (H7788_05710) | - | 1143793..1144311 (-) | 519 | WP_030127443.1 | phage major tail protein, TP901-1 family | - |
| H7788_RS05720 (H7788_05715) | - | 1144299..1144697 (-) | 399 | WP_030127442.1 | DUF3168 domain-containing protein | - |
| H7788_RS05725 (H7788_05720) | - | 1144694..1145050 (-) | 357 | WP_030127441.1 | HK97-gp10 family putative phage morphogenesis protein | - |
| H7788_RS05730 (H7788_05725) | - | 1145050..1145346 (-) | 297 | WP_030127440.1 | hypothetical protein | - |
| H7788_RS05735 (H7788_05730) | - | 1145343..1145696 (-) | 354 | WP_030127439.1 | phage head-tail connector protein | - |
| H7788_RS05740 (H7788_05735) | - | 1145708..1145974 (-) | 267 | WP_030127438.1 | HeH/LEM domain-containing protein | - |
| H7788_RS05745 (H7788_05740) | - | 1145986..1147035 (-) | 1050 | WP_030127437.1 | major capsid protein | - |
| H7788_RS05750 (H7788_05745) | - | 1147038..1147418 (-) | 381 | WP_002990036.1 | structural protein | - |
| H7788_RS05755 (H7788_05750) | - | 1147428..1147961 (-) | 534 | WP_030127436.1 | DUF4355 domain-containing protein | - |
| H7788_RS05760 (H7788_05755) | - | 1148105..1148371 (-) | 267 | WP_030127435.1 | hypothetical protein | - |
| H7788_RS05765 (H7788_05760) | - | 1148387..1149301 (-) | 915 | WP_030127434.1 | minor capsid protein | - |
| H7788_RS05770 (H7788_05765) | - | 1149282..1150772 (-) | 1491 | WP_032461297.1 | phage portal protein | - |
| H7788_RS05775 (H7788_05770) | - | 1150784..1152091 (-) | 1308 | WP_014635515.1 | PBSX family phage terminase large subunit | - |
| H7788_RS05780 (H7788_05775) | - | 1152069..1152521 (-) | 453 | WP_030127432.1 | terminase small subunit | - |
| H7788_RS05785 (H7788_05780) | - | 1152611..1153027 (-) | 417 | WP_011054881.1 | transcriptional regulator | - |
| H7788_RS05790 (H7788_05785) | - | 1153011..1153157 (-) | 147 | WP_023079210.1 | hypothetical protein | - |
| H7788_RS05795 (H7788_05790) | - | 1153160..1153432 (-) | 273 | WP_011054882.1 | hypothetical protein | - |
| H7788_RS05800 (H7788_05795) | - | 1153425..1153595 (-) | 171 | WP_164972002.1 | hypothetical protein | - |
| H7788_RS05805 (H7788_05800) | - | 1153596..1154918 (-) | 1323 | WP_030127431.1 | SNF2-related protein | - |
| H7788_RS05810 (H7788_05805) | - | 1154915..1155190 (-) | 276 | WP_011054885.1 | VRR-NUC domain-containing protein | - |
| H7788_RS05815 (H7788_05810) | - | 1155576..1157960 (-) | 2385 | WP_085613976.1 | phage/plasmid primase, P4 family | - |
| H7788_RS05820 (H7788_05815) | - | 1157965..1159887 (-) | 1923 | WP_030127429.1 | DNA polymerase | - |
| H7788_RS05825 (H7788_05820) | - | 1159930..1160493 (-) | 564 | WP_086934854.1 | DUF2815 family protein | - |
| H7788_RS05830 (H7788_05825) | - | 1160502..1161659 (-) | 1158 | WP_030127428.1 | DUF2800 domain-containing protein | - |
| H7788_RS05835 (H7788_05830) | - | 1161659..1161958 (-) | 300 | WP_030127427.1 | hypothetical protein | - |
| H7788_RS05840 (H7788_05835) | - | 1162046..1162249 (-) | 204 | WP_030127426.1 | hypothetical protein | - |
| H7788_RS05845 (H7788_05840) | - | 1162246..1162398 (-) | 153 | WP_017647437.1 | hypothetical protein | - |
| H7788_RS05850 (H7788_05845) | - | 1162395..1162781 (-) | 387 | WP_030127425.1 | hypothetical protein | - |
| H7788_RS05855 (H7788_05850) | - | 1162778..1162981 (-) | 204 | WP_030127424.1 | hypothetical protein | - |
| H7788_RS05860 (H7788_05855) | - | 1162974..1163144 (-) | 171 | WP_023611037.1 | hypothetical protein | - |
| H7788_RS05865 (H7788_05860) | - | 1163146..1163457 (-) | 312 | WP_014411880.1 | hypothetical protein | - |
| H7788_RS05870 (H7788_05865) | - | 1163536..1163721 (-) | 186 | WP_011054585.1 | helix-turn-helix domain-containing protein | - |
| H7788_RS05875 (H7788_05870) | - | 1163888..1164127 (+) | 240 | WP_011284879.1 | hypothetical protein | - |
| H7788_RS05880 (H7788_05875) | - | 1164277..1164486 (+) | 210 | WP_002984292.1 | hypothetical protein | - |
| H7788_RS05885 (H7788_05880) | - | 1164732..1164938 (-) | 207 | WP_001157159.1 | helix-turn-helix domain-containing protein | - |
| H7788_RS05890 (H7788_05885) | - | 1165012..1165494 (+) | 483 | WP_021340824.1 | hypothetical protein | - |
| H7788_RS05895 (H7788_05890) | - | 1165491..1165637 (-) | 147 | WP_021340823.1 | hypothetical protein | - |
| H7788_RS05900 (H7788_05895) | - | 1165692..1166291 (+) | 600 | WP_030127422.1 | hypothetical protein | - |
| H7788_RS05905 (H7788_05900) | - | 1166322..1166480 (-) | 159 | WP_076636802.1 | hypothetical protein | - |
| H7788_RS05910 (H7788_05905) | - | 1166870..1167628 (+) | 759 | WP_030127421.1 | XRE family transcriptional regulator | - |
| H7788_RS05915 (H7788_05910) | - | 1167663..1168343 (+) | 681 | WP_030127420.1 | hypothetical protein | - |
| H7788_RS05920 (H7788_05915) | - | 1168480..1169622 (+) | 1143 | WP_003051793.1 | tyrosine-type recombinase/integrase | - |
| H7788_RS05925 (H7788_05920) | - | 1169712..1169987 (-) | 276 | WP_002983920.1 | HU family DNA-binding protein | - |
| H7788_RS05930 (H7788_05925) | - | 1170086..1170673 (-) | 588 | WP_002989129.1 | YpmS family protein | - |
| H7788_RS05935 (H7788_05930) | - | 1170651..1171493 (-) | 843 | WP_002992620.1 | SGNH/GDSL hydrolase family protein | - |
Sequence
Protein
Download Length: 60 a.a. Molecular weight: 6841.79 Da Isoelectric Point: 4.5183
>NTDB_id=477424 H7788_RS05630 WP_011017964.1 1128750..1128932(-) (prx) [Streptococcus pyogenes strain TSPY136]
MLTYDEFKQAIDNGYIAGDTVAIVRKDGQIFDYVLPHEKVKNGEVVTKEKVEEVLVELSR
MLTYDEFKQAIDNGYIAGDTVAIVRKDGQIFDYVLPHEKVKNGEVVTKEKVEEVLVELSR
Nucleotide
Download Length: 183 bp
>NTDB_id=477424 H7788_RS05630 WP_011017964.1 1128750..1128932(-) (prx) [Streptococcus pyogenes strain TSPY136]
ATGCTAACATACGACGAGTTTAAGCAAGCGATTGACAATGGATATATCGCAGGCGATACAGTAGCGATCGTGCGTAAAGA
CGGACAGATTTTTGATTATGTGTTGCCACATGAGAAAGTAAAGAATGGAGAAGTTGTGACTAAGGAAAAAGTGGAAGAGG
TGCTGGTGGAGCTTTCGAGATAA
ATGCTAACATACGACGAGTTTAAGCAAGCGATTGACAATGGATATATCGCAGGCGATACAGTAGCGATCGTGCGTAAAGA
CGGACAGATTTTTGATTATGTGTTGCCACATGAGAAAGTAAAGAATGGAGAAGTTGTGACTAAGGAAAAAGTGGAAGAGG
TGCTGGTGGAGCTTTCGAGATAA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS8232 |
100 |
100 |
1 |
| prx | Streptococcus pyogenes MGAS315 |
85 |
100 |
0.85 |
| prx | Streptococcus pyogenes MGAS315 |
80 |
100 |
0.8 |
| prx | Streptococcus pyogenes MGAS315 |
73.333 |
100 |
0.733 |
| prx | Streptococcus pyogenes MGAS315 |
90.244 |
68.333 |
0.617 |
| prx | Streptococcus pyogenes MGAS315 |
83.721 |
71.667 |
0.6 |
| prx | Streptococcus pyogenes MGAS315 |
78.571 |
70 |
0.55 |