Detailed information
Overview
| Name | prx | Type | Regulator |
| Locus tag | H7788_RS03120 | Genome accession | NZ_CP060647 |
| Coordinates | 591983..592162 (+) | Length | 59 a.a. |
| NCBI ID | WP_030127450.1 | Uniprot ID | - |
| Organism | Streptococcus pyogenes strain TSPY136 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 545389..595519 | 591983..592162 | within | 0 |
Gene organization within MGE regions
Location: 545389..595519
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| H7788_RS02800 (H7788_02800) | - | 545389..546330 (-) | 942 | WP_011017597.1 | DHH family phosphoesterase | - |
| H7788_RS02805 (H7788_02805) | - | 546724..547173 (+) | 450 | WP_002985303.1 | flavodoxin | - |
| H7788_RS02810 (H7788_02810) | - | 547349..547633 (+) | 285 | WP_030127671.1 | chorismate mutase | - |
| H7788_RS02815 (H7788_02815) | - | 547626..548888 (+) | 1263 | WP_030127672.1 | voltage-gated chloride channel family protein | - |
| H7788_RS02820 (H7788_02820) | rplS | 549003..549350 (+) | 348 | WP_002985298.1 | 50S ribosomal protein L19 | - |
| H7788_RS02830 (H7788_02830) | - | 549713..550789 (-) | 1077 | WP_023612372.1 | tyrosine-type recombinase/integrase | - |
| H7788_RS02835 (H7788_02835) | - | 550908..551429 (-) | 522 | WP_023612337.1 | hypothetical protein | - |
| H7788_RS02840 (H7788_02840) | - | 551440..551817 (-) | 378 | WP_030126053.1 | ImmA/IrrE family metallo-endopeptidase | - |
| H7788_RS02845 (H7788_02845) | - | 551801..552160 (-) | 360 | WP_023611288.1 | helix-turn-helix domain-containing protein | - |
| H7788_RS02850 (H7788_02850) | - | 552348..552566 (+) | 219 | WP_023612341.1 | helix-turn-helix domain-containing protein | - |
| H7788_RS02855 (H7788_02855) | - | 552667..552897 (+) | 231 | WP_023612302.1 | hypothetical protein | - |
| H7788_RS02860 (H7788_02860) | - | 552881..553024 (+) | 144 | WP_164492191.1 | hypothetical protein | - |
| H7788_RS02865 (H7788_02865) | - | 553034..553252 (+) | 219 | WP_023612348.1 | hypothetical protein | - |
| H7788_RS02870 (H7788_02870) | - | 553254..553496 (+) | 243 | WP_003056170.1 | hypothetical protein | - |
| H7788_RS02875 (H7788_02875) | - | 553480..554799 (+) | 1320 | WP_030127673.1 | AAA family ATPase | - |
| H7788_RS02880 (H7788_02880) | - | 554814..555896 (+) | 1083 | WP_003056188.1 | ATP-binding protein | - |
| H7788_RS08795 | - | 555935..556069 (+) | 135 | WP_023612344.1 | hypothetical protein | - |
| H7788_RS02885 (H7788_02885) | - | 556091..556684 (+) | 594 | WP_003056185.1 | hypothetical protein | - |
| H7788_RS02890 (H7788_02890) | - | 556684..558267 (+) | 1584 | WP_080262841.1 | DEAD/DEAH box helicase | - |
| H7788_RS02895 (H7788_02895) | - | 558280..558474 (+) | 195 | WP_023612331.1 | hypothetical protein | - |
| H7788_RS02900 (H7788_02900) | - | 558497..560740 (+) | 2244 | WP_023612365.1 | AAA family ATPase | - |
| H7788_RS02905 (H7788_02905) | - | 561032..561214 (+) | 183 | WP_003059078.1 | hypothetical protein | - |
| H7788_RS02910 (H7788_02910) | - | 561207..561602 (+) | 396 | WP_023612320.1 | RusA family crossover junction endodeoxyribonuclease | - |
| H7788_RS02915 (H7788_02915) | - | 561599..561823 (+) | 225 | WP_023612313.1 | hypothetical protein | - |
| H7788_RS02920 (H7788_02920) | - | 561826..562011 (+) | 186 | WP_023612326.1 | hypothetical protein | - |
| H7788_RS02925 (H7788_02925) | - | 562008..562259 (+) | 252 | WP_023612315.1 | hypothetical protein | - |
| H7788_RS02930 (H7788_02930) | - | 562243..562647 (+) | 405 | WP_023612304.1 | YopX family protein | - |
| H7788_RS02935 (H7788_02935) | - | 562644..562928 (+) | 285 | WP_014411870.1 | hypothetical protein | - |
| H7788_RS02940 (H7788_02940) | - | 562930..563562 (+) | 633 | WP_011018133.1 | N-6 DNA methylase | - |
| H7788_RS02945 (H7788_02945) | - | 563565..564275 (+) | 711 | WP_014411869.1 | DUF1642 domain-containing protein | - |
| H7788_RS02950 (H7788_02950) | - | 564272..564643 (+) | 372 | WP_014411868.1 | hypothetical protein | - |
| H7788_RS02955 (H7788_02955) | - | 564911..565348 (+) | 438 | WP_021340586.1 | DUF1492 domain-containing protein | - |
| H7788_RS02960 (H7788_02960) | - | 565867..566124 (-) | 258 | WP_011054748.1 | hypothetical protein | - |
| H7788_RS02965 (H7788_02965) | - | 566205..566723 (+) | 519 | WP_002986854.1 | ParB N-terminal domain-containing protein | - |
| H7788_RS02970 (H7788_02970) | - | 566702..567379 (+) | 678 | WP_002986850.1 | ABC transporter ATP-binding protein | - |
| H7788_RS02975 (H7788_02975) | - | 567388..567771 (+) | 384 | WP_076639321.1 | GNAT family N-acetyltransferase | - |
| H7788_RS02980 (H7788_02980) | - | 567832..568209 (+) | 378 | WP_002986841.1 | ASCH domain-containing protein | - |
| H7788_RS02985 (H7788_02985) | - | 568251..568733 (+) | 483 | WP_227874485.1 | hypothetical protein | - |
| H7788_RS02990 (H7788_02990) | - | 568816..570027 (+) | 1212 | WP_010922074.1 | PBSX family phage terminase large subunit | - |
| H7788_RS02995 (H7788_02995) | - | 570041..571543 (+) | 1503 | WP_002986832.1 | phage portal protein | - |
| H7788_RS03000 (H7788_03000) | - | 571548..573026 (+) | 1479 | WP_011054746.1 | phage minor capsid protein | - |
| H7788_RS03005 (H7788_03005) | - | 572998..573237 (+) | 240 | WP_002986829.1 | hypothetical protein | - |
| H7788_RS03010 (H7788_03010) | - | 573299..573565 (+) | 267 | WP_011054745.1 | hypothetical protein | - |
| H7788_RS03015 (H7788_03015) | - | 573691..574305 (+) | 615 | WP_011106689.1 | hypothetical protein | - |
| H7788_RS03020 (H7788_03020) | - | 574309..575127 (+) | 819 | WP_010922080.1 | N4-gp56 family major capsid protein | - |
| H7788_RS03025 (H7788_03025) | - | 575181..575597 (+) | 417 | WP_011054743.1 | hypothetical protein | - |
| H7788_RS03030 (H7788_03030) | - | 575587..575919 (+) | 333 | WP_010922082.1 | minor capsid protein | - |
| H7788_RS03035 (H7788_03035) | - | 575919..576275 (+) | 357 | WP_010922083.1 | minor capsid protein | - |
| H7788_RS03040 (H7788_03040) | - | 576272..576670 (+) | 399 | WP_010922084.1 | minor capsid protein | - |
| H7788_RS03045 (H7788_03045) | - | 576670..577155 (+) | 486 | WP_011054741.1 | phage tail tube protein | - |
| H7788_RS03050 (H7788_03050) | - | 577194..577628 (+) | 435 | WP_011054740.1 | hypothetical protein | - |
| H7788_RS03055 (H7788_03055) | - | 577632..578213 (+) | 582 | WP_011284973.1 | bacteriophage Gp15 family protein | - |
| H7788_RS03060 (H7788_03060) | - | 578203..581463 (+) | 3261 | WP_023612368.1 | tape measure protein | - |
| H7788_RS03065 (H7788_03065) | - | 581460..582176 (+) | 717 | WP_011054737.1 | distal tail protein Dit | - |
| H7788_RS03070 (H7788_03070) | - | 582173..584320 (+) | 2148 | WP_011284971.1 | phage tail spike protein | - |
| H7788_RS03075 (H7788_03075) | - | 584317..585531 (+) | 1215 | WP_011284843.1 | hypothetical protein | - |
| H7788_RS03080 (H7788_03080) | - | 585533..585847 (+) | 315 | WP_021340983.1 | hypothetical protein | - |
| H7788_RS03085 (H7788_03085) | - | 585858..587747 (+) | 1890 | WP_047235372.1 | gp58-like family protein | - |
| H7788_RS03090 (H7788_03090) | - | 587759..588187 (+) | 429 | WP_002988448.1 | DUF1617 family protein | - |
| H7788_RS03095 (H7788_03095) | - | 588190..588822 (+) | 633 | WP_011054443.1 | hypothetical protein | - |
| H7788_RS03100 (H7788_03100) | - | 588834..589106 (+) | 273 | WP_011017397.1 | hypothetical protein | - |
| H7788_RS03105 (H7788_03105) | - | 589103..589330 (+) | 228 | WP_011054444.1 | phage holin | - |
| H7788_RS03110 (H7788_03110) | - | 589446..590654 (+) | 1209 | WP_011054445.1 | glucosaminidase domain-containing protein | - |
| H7788_RS03115 (H7788_03115) | - | 590764..591750 (-) | 987 | WP_050440680.1 | DNA/RNA non-specific endonuclease | - |
| H7788_RS03120 (H7788_03120) | prx | 591983..592162 (+) | 180 | WP_030127450.1 | hypothetical protein | Regulator |
| H7788_RS08865 | - | 592343..592627 (-) | 285 | Protein_570 | site-specific integrase | - |
| H7788_RS03125 | - | 592632..592911 (+) | 280 | Protein_571 | rod shape-determining protein RodA | - |
| H7788_RS03130 (H7788_03125) | - | 593006..593566 (+) | 561 | WP_002990461.1 | HAD-IA family hydrolase | - |
| H7788_RS03135 (H7788_03130) | gyrB | 593567..595519 (+) | 1953 | WP_002994058.1 | DNA topoisomerase (ATP-hydrolyzing) subunit B | - |
Sequence
Protein
Download Length: 59 a.a. Molecular weight: 6979.01 Da Isoelectric Point: 3.8662
>NTDB_id=477416 H7788_RS03120 WP_030127450.1 591983..592162(+) (prx) [Streptococcus pyogenes strain TSPY136]
MLTYDEFKQAIDDGYITTDAVMIVRKNGQIFDYVLPGEEVRPWEIVIEERVAEVLMELW
MLTYDEFKQAIDDGYITTDAVMIVRKNGQIFDYVLPGEEVRPWEIVIEERVAEVLMELW
Nucleotide
Download Length: 180 bp
>NTDB_id=477416 H7788_RS03120 WP_030127450.1 591983..592162(+) (prx) [Streptococcus pyogenes strain TSPY136]
ATGCTAACATACGACGAATTTAAGCAAGCAATTGATGACGGCTATATCACAACAGACGCAGTAATGATCGTGCGCAAGAA
CGGACAAATTTTTGATTATGTCTTGCCAGGAGAGGAAGTCAGGCCATGGGAGATTGTGATCGAGGAGAGGGTGGCGGAGG
TGTTGATGGAATTGTGGTGA
ATGCTAACATACGACGAATTTAAGCAAGCAATTGATGACGGCTATATCACAACAGACGCAGTAATGATCGTGCGCAAGAA
CGGACAAATTTTTGATTATGTCTTGCCAGGAGAGGAAGTCAGGCCATGGGAGATTGTGATCGAGGAGAGGGTGGCGGAGG
TGTTGATGGAATTGTGGTGA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS315 |
81.034 |
98.305 |
0.797 |
| prx | Streptococcus pyogenes MGAS315 |
77.586 |
98.305 |
0.763 |
| prx | Streptococcus pyogenes MGAS315 |
75.862 |
98.305 |
0.746 |
| prx | Streptococcus pyogenes MGAS8232 |
70.69 |
98.305 |
0.695 |
| prx | Streptococcus pyogenes MGAS315 |
87.805 |
69.492 |
0.61 |
| prx | Streptococcus pyogenes MGAS315 |
85.714 |
71.186 |
0.61 |
| prx | Streptococcus pyogenes MGAS315 |
73.171 |
69.492 |
0.508 |