Detailed information    

insolico Bioinformatically predicted

Overview


Name   prx   Type   Regulator
Locus tag   H7788_RS03120 Genome accession   NZ_CP060647
Coordinates   591983..592162 (+) Length   59 a.a.
NCBI ID   WP_030127450.1    Uniprot ID   -
Organism   Streptococcus pyogenes strain TSPY136     
Function   Inhibit ComR activation (predicted from homology)   
Competence regulation

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 545389..595519 591983..592162 within 0


Gene organization within MGE regions


Location: 545389..595519
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  H7788_RS02800 (H7788_02800) - 545389..546330 (-) 942 WP_011017597.1 DHH family phosphoesterase -
  H7788_RS02805 (H7788_02805) - 546724..547173 (+) 450 WP_002985303.1 flavodoxin -
  H7788_RS02810 (H7788_02810) - 547349..547633 (+) 285 WP_030127671.1 chorismate mutase -
  H7788_RS02815 (H7788_02815) - 547626..548888 (+) 1263 WP_030127672.1 voltage-gated chloride channel family protein -
  H7788_RS02820 (H7788_02820) rplS 549003..549350 (+) 348 WP_002985298.1 50S ribosomal protein L19 -
  H7788_RS02830 (H7788_02830) - 549713..550789 (-) 1077 WP_023612372.1 tyrosine-type recombinase/integrase -
  H7788_RS02835 (H7788_02835) - 550908..551429 (-) 522 WP_023612337.1 hypothetical protein -
  H7788_RS02840 (H7788_02840) - 551440..551817 (-) 378 WP_030126053.1 ImmA/IrrE family metallo-endopeptidase -
  H7788_RS02845 (H7788_02845) - 551801..552160 (-) 360 WP_023611288.1 helix-turn-helix domain-containing protein -
  H7788_RS02850 (H7788_02850) - 552348..552566 (+) 219 WP_023612341.1 helix-turn-helix domain-containing protein -
  H7788_RS02855 (H7788_02855) - 552667..552897 (+) 231 WP_023612302.1 hypothetical protein -
  H7788_RS02860 (H7788_02860) - 552881..553024 (+) 144 WP_164492191.1 hypothetical protein -
  H7788_RS02865 (H7788_02865) - 553034..553252 (+) 219 WP_023612348.1 hypothetical protein -
  H7788_RS02870 (H7788_02870) - 553254..553496 (+) 243 WP_003056170.1 hypothetical protein -
  H7788_RS02875 (H7788_02875) - 553480..554799 (+) 1320 WP_030127673.1 AAA family ATPase -
  H7788_RS02880 (H7788_02880) - 554814..555896 (+) 1083 WP_003056188.1 ATP-binding protein -
  H7788_RS08795 - 555935..556069 (+) 135 WP_023612344.1 hypothetical protein -
  H7788_RS02885 (H7788_02885) - 556091..556684 (+) 594 WP_003056185.1 hypothetical protein -
  H7788_RS02890 (H7788_02890) - 556684..558267 (+) 1584 WP_080262841.1 DEAD/DEAH box helicase -
  H7788_RS02895 (H7788_02895) - 558280..558474 (+) 195 WP_023612331.1 hypothetical protein -
  H7788_RS02900 (H7788_02900) - 558497..560740 (+) 2244 WP_023612365.1 AAA family ATPase -
  H7788_RS02905 (H7788_02905) - 561032..561214 (+) 183 WP_003059078.1 hypothetical protein -
  H7788_RS02910 (H7788_02910) - 561207..561602 (+) 396 WP_023612320.1 RusA family crossover junction endodeoxyribonuclease -
  H7788_RS02915 (H7788_02915) - 561599..561823 (+) 225 WP_023612313.1 hypothetical protein -
  H7788_RS02920 (H7788_02920) - 561826..562011 (+) 186 WP_023612326.1 hypothetical protein -
  H7788_RS02925 (H7788_02925) - 562008..562259 (+) 252 WP_023612315.1 hypothetical protein -
  H7788_RS02930 (H7788_02930) - 562243..562647 (+) 405 WP_023612304.1 YopX family protein -
  H7788_RS02935 (H7788_02935) - 562644..562928 (+) 285 WP_014411870.1 hypothetical protein -
  H7788_RS02940 (H7788_02940) - 562930..563562 (+) 633 WP_011018133.1 N-6 DNA methylase -
  H7788_RS02945 (H7788_02945) - 563565..564275 (+) 711 WP_014411869.1 DUF1642 domain-containing protein -
  H7788_RS02950 (H7788_02950) - 564272..564643 (+) 372 WP_014411868.1 hypothetical protein -
  H7788_RS02955 (H7788_02955) - 564911..565348 (+) 438 WP_021340586.1 DUF1492 domain-containing protein -
  H7788_RS02960 (H7788_02960) - 565867..566124 (-) 258 WP_011054748.1 hypothetical protein -
  H7788_RS02965 (H7788_02965) - 566205..566723 (+) 519 WP_002986854.1 ParB N-terminal domain-containing protein -
  H7788_RS02970 (H7788_02970) - 566702..567379 (+) 678 WP_002986850.1 ABC transporter ATP-binding protein -
  H7788_RS02975 (H7788_02975) - 567388..567771 (+) 384 WP_076639321.1 GNAT family N-acetyltransferase -
  H7788_RS02980 (H7788_02980) - 567832..568209 (+) 378 WP_002986841.1 ASCH domain-containing protein -
  H7788_RS02985 (H7788_02985) - 568251..568733 (+) 483 WP_227874485.1 hypothetical protein -
  H7788_RS02990 (H7788_02990) - 568816..570027 (+) 1212 WP_010922074.1 PBSX family phage terminase large subunit -
  H7788_RS02995 (H7788_02995) - 570041..571543 (+) 1503 WP_002986832.1 phage portal protein -
  H7788_RS03000 (H7788_03000) - 571548..573026 (+) 1479 WP_011054746.1 phage minor capsid protein -
  H7788_RS03005 (H7788_03005) - 572998..573237 (+) 240 WP_002986829.1 hypothetical protein -
  H7788_RS03010 (H7788_03010) - 573299..573565 (+) 267 WP_011054745.1 hypothetical protein -
  H7788_RS03015 (H7788_03015) - 573691..574305 (+) 615 WP_011106689.1 hypothetical protein -
  H7788_RS03020 (H7788_03020) - 574309..575127 (+) 819 WP_010922080.1 N4-gp56 family major capsid protein -
  H7788_RS03025 (H7788_03025) - 575181..575597 (+) 417 WP_011054743.1 hypothetical protein -
  H7788_RS03030 (H7788_03030) - 575587..575919 (+) 333 WP_010922082.1 minor capsid protein -
  H7788_RS03035 (H7788_03035) - 575919..576275 (+) 357 WP_010922083.1 minor capsid protein -
  H7788_RS03040 (H7788_03040) - 576272..576670 (+) 399 WP_010922084.1 minor capsid protein -
  H7788_RS03045 (H7788_03045) - 576670..577155 (+) 486 WP_011054741.1 phage tail tube protein -
  H7788_RS03050 (H7788_03050) - 577194..577628 (+) 435 WP_011054740.1 hypothetical protein -
  H7788_RS03055 (H7788_03055) - 577632..578213 (+) 582 WP_011284973.1 bacteriophage Gp15 family protein -
  H7788_RS03060 (H7788_03060) - 578203..581463 (+) 3261 WP_023612368.1 tape measure protein -
  H7788_RS03065 (H7788_03065) - 581460..582176 (+) 717 WP_011054737.1 distal tail protein Dit -
  H7788_RS03070 (H7788_03070) - 582173..584320 (+) 2148 WP_011284971.1 phage tail spike protein -
  H7788_RS03075 (H7788_03075) - 584317..585531 (+) 1215 WP_011284843.1 hypothetical protein -
  H7788_RS03080 (H7788_03080) - 585533..585847 (+) 315 WP_021340983.1 hypothetical protein -
  H7788_RS03085 (H7788_03085) - 585858..587747 (+) 1890 WP_047235372.1 gp58-like family protein -
  H7788_RS03090 (H7788_03090) - 587759..588187 (+) 429 WP_002988448.1 DUF1617 family protein -
  H7788_RS03095 (H7788_03095) - 588190..588822 (+) 633 WP_011054443.1 hypothetical protein -
  H7788_RS03100 (H7788_03100) - 588834..589106 (+) 273 WP_011017397.1 hypothetical protein -
  H7788_RS03105 (H7788_03105) - 589103..589330 (+) 228 WP_011054444.1 phage holin -
  H7788_RS03110 (H7788_03110) - 589446..590654 (+) 1209 WP_011054445.1 glucosaminidase domain-containing protein -
  H7788_RS03115 (H7788_03115) - 590764..591750 (-) 987 WP_050440680.1 DNA/RNA non-specific endonuclease -
  H7788_RS03120 (H7788_03120) prx 591983..592162 (+) 180 WP_030127450.1 hypothetical protein Regulator
  H7788_RS08865 - 592343..592627 (-) 285 Protein_570 site-specific integrase -
  H7788_RS03125 - 592632..592911 (+) 280 Protein_571 rod shape-determining protein RodA -
  H7788_RS03130 (H7788_03125) - 593006..593566 (+) 561 WP_002990461.1 HAD-IA family hydrolase -
  H7788_RS03135 (H7788_03130) gyrB 593567..595519 (+) 1953 WP_002994058.1 DNA topoisomerase (ATP-hydrolyzing) subunit B -

Sequence


Protein


Download         Length: 59 a.a.        Molecular weight: 6979.01 Da        Isoelectric Point: 3.8662

>NTDB_id=477416 H7788_RS03120 WP_030127450.1 591983..592162(+) (prx) [Streptococcus pyogenes strain TSPY136]
MLTYDEFKQAIDDGYITTDAVMIVRKNGQIFDYVLPGEEVRPWEIVIEERVAEVLMELW

Nucleotide


Download         Length: 180 bp        

>NTDB_id=477416 H7788_RS03120 WP_030127450.1 591983..592162(+) (prx) [Streptococcus pyogenes strain TSPY136]
ATGCTAACATACGACGAATTTAAGCAAGCAATTGATGACGGCTATATCACAACAGACGCAGTAATGATCGTGCGCAAGAA
CGGACAAATTTTTGATTATGTCTTGCCAGGAGAGGAAGTCAGGCCATGGGAGATTGTGATCGAGGAGAGGGTGGCGGAGG
TGTTGATGGAATTGTGGTGA

Domains



No domain identified.



Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  prx Streptococcus pyogenes MGAS315

81.034

98.305

0.797

  prx Streptococcus pyogenes MGAS315

77.586

98.305

0.763

  prx Streptococcus pyogenes MGAS315

75.862

98.305

0.746

  prx Streptococcus pyogenes MGAS8232

70.69

98.305

0.695

  prx Streptococcus pyogenes MGAS315

87.805

69.492

0.61

  prx Streptococcus pyogenes MGAS315

85.714

71.186

0.61

  prx Streptococcus pyogenes MGAS315

73.171

69.492

0.508