Detailed information
Bioinformatically predicted
Overview
| Name | prx | Type | Regulator |
| Locus tag | H7789_RS03510 | Genome accession | NZ_CP060646 |
| Coordinates | 676599..676781 (+) | Length | 60 a.a. |
| NCBI ID | WP_136084463.1 | Uniprot ID | - |
| Organism | Streptococcus pyogenes strain TSPY1026 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 633678..676781 | 676599..676781 | within | 0 |
Gene organization within MGE regions
Location: 633678..676781
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| H7789_RS03175 (H7789_03180) | - | 633678..633953 (+) | 276 | WP_002983920.1 | HU family DNA-binding protein | - |
| H7789_RS03180 (H7789_03185) | - | 634043..635185 (-) | 1143 | WP_003051793.1 | tyrosine-type recombinase/integrase | - |
| H7789_RS03185 (H7789_03190) | - | 635322..636002 (-) | 681 | WP_002990092.1 | hypothetical protein | - |
| H7789_RS03190 (H7789_03195) | - | 636040..636774 (-) | 735 | WP_228628304.1 | XRE family transcriptional regulator | - |
| H7789_RS03195 (H7789_03200) | - | 636934..637161 (+) | 228 | WP_002990088.1 | hypothetical protein | - |
| H7789_RS03200 (H7789_03205) | - | 637212..637940 (+) | 729 | WP_136084483.1 | phage antirepressor KilAC domain-containing protein | - |
| H7789_RS03205 (H7789_03210) | - | 637972..638238 (+) | 267 | WP_010922204.1 | hypothetical protein | - |
| H7789_RS03210 (H7789_03215) | - | 638173..638979 (-) | 807 | WP_011285629.1 | TIGR02391 family protein | - |
| H7789_RS03215 (H7789_03220) | - | 639121..639360 (-) | 240 | WP_011284879.1 | hypothetical protein | - |
| H7789_RS03220 (H7789_03225) | - | 639527..639712 (+) | 186 | WP_011054585.1 | helix-turn-helix domain-containing protein | - |
| H7789_RS03225 (H7789_03230) | - | 639790..640101 (+) | 312 | WP_002990080.1 | hypothetical protein | - |
| H7789_RS03230 (H7789_03235) | - | 640103..640288 (+) | 186 | WP_002990078.1 | hypothetical protein | - |
| H7789_RS03235 | - | 640388..640627 (+) | 240 | WP_002985390.1 | hypothetical protein | - |
| H7789_RS03240 (H7789_03240) | - | 640772..641161 (+) | 390 | WP_011285627.1 | DnaD domain-containing protein | - |
| H7789_RS03245 (H7789_03245) | - | 641142..641375 (+) | 234 | WP_002985387.1 | hypothetical protein | - |
| H7789_RS03250 (H7789_03250) | - | 641372..641512 (+) | 141 | WP_136084482.1 | hypothetical protein | - |
| H7789_RS03255 (H7789_03255) | - | 641521..641727 (+) | 207 | WP_011017565.1 | hypothetical protein | - |
| H7789_RS03260 (H7789_03260) | - | 641783..642112 (+) | 330 | WP_085613678.1 | hypothetical protein | - |
| H7789_RS03265 (H7789_03265) | bet | 642115..642906 (+) | 792 | WP_228628306.1 | phage recombination protein Bet | - |
| H7789_RS03270 (H7789_03270) | - | 642916..643734 (+) | 819 | Protein_585 | DUF1351 domain-containing protein | - |
| H7789_RS03275 (H7789_03275) | - | 643730..644341 (+) | 612 | Protein_586 | hypothetical protein | - |
| H7789_RS03280 (H7789_03280) | - | 644536..644874 (+) | 339 | WP_002990067.1 | hypothetical protein | - |
| H7789_RS03285 (H7789_03285) | - | 644871..645383 (+) | 513 | WP_002988366.1 | hypothetical protein | - |
| H7789_RS03290 (H7789_03290) | - | 645370..645573 (+) | 204 | WP_063629031.1 | hypothetical protein | - |
| H7789_RS03295 (H7789_03295) | - | 645560..645844 (+) | 285 | WP_136084481.1 | hypothetical protein | - |
| H7789_RS03300 (H7789_03300) | - | 646007..646093 (+) | 87 | Protein_591 | SAM-dependent methyltransferase | - |
| H7789_RS03305 (H7789_03305) | - | 646083..646847 (+) | 765 | WP_032463361.1 | DNA-methyltransferase | - |
| H7789_RS03310 (H7789_03310) | - | 646895..647188 (+) | 294 | WP_032460172.1 | hypothetical protein | - |
| H7789_RS03315 (H7789_03315) | - | 647553..647990 (+) | 438 | WP_021340586.1 | DUF1492 domain-containing protein | - |
| H7789_RS03320 (H7789_03320) | - | 648565..648822 (-) | 258 | WP_011054748.1 | hypothetical protein | - |
| H7789_RS03325 (H7789_03325) | - | 648903..649421 (+) | 519 | WP_136026505.1 | ParB N-terminal domain-containing protein | - |
| H7789_RS03330 (H7789_03330) | - | 649400..650077 (+) | 678 | WP_002986850.1 | ABC transporter ATP-binding protein | - |
| H7789_RS03335 (H7789_03335) | - | 650086..650469 (+) | 384 | WP_136278146.1 | GNAT family N-acetyltransferase | - |
| H7789_RS03340 (H7789_03340) | - | 650530..650907 (+) | 378 | WP_032459833.1 | ASCH domain-containing protein | - |
| H7789_RS03345 (H7789_03345) | - | 650957..651406 (+) | 450 | WP_281726933.1 | hypothetical protein | - |
| H7789_RS03350 (H7789_03350) | - | 651403..652647 (+) | 1245 | WP_023611361.1 | PBSX family phage terminase large subunit | - |
| H7789_RS03355 (H7789_03355) | - | 652659..654149 (+) | 1491 | WP_136084479.1 | phage portal protein | - |
| H7789_RS03360 (H7789_03360) | - | 654130..655044 (+) | 915 | WP_136084478.1 | minor capsid protein | - |
| H7789_RS03365 (H7789_03365) | - | 655060..655326 (+) | 267 | WP_136084477.1 | hypothetical protein | - |
| H7789_RS03370 (H7789_03370) | - | 655470..656003 (+) | 534 | WP_030127436.1 | DUF4355 domain-containing protein | - |
| H7789_RS03375 (H7789_03375) | - | 656013..656393 (+) | 381 | WP_002990036.1 | structural protein | - |
| H7789_RS03380 (H7789_03380) | - | 656396..657445 (+) | 1050 | WP_030127437.1 | major capsid protein | - |
| H7789_RS03385 (H7789_03385) | - | 657457..657723 (+) | 267 | WP_030127438.1 | HeH/LEM domain-containing protein | - |
| H7789_RS03390 (H7789_03390) | - | 657735..658088 (+) | 354 | WP_030127439.1 | phage head-tail connector protein | - |
| H7789_RS03395 (H7789_03395) | - | 658085..658381 (+) | 297 | WP_030127440.1 | hypothetical protein | - |
| H7789_RS03400 (H7789_03400) | - | 658381..658737 (+) | 357 | WP_030127441.1 | HK97-gp10 family putative phage morphogenesis protein | - |
| H7789_RS03405 (H7789_03405) | - | 658734..659132 (+) | 399 | WP_030127442.1 | DUF3168 domain-containing protein | - |
| H7789_RS03410 (H7789_03410) | - | 659120..659638 (+) | 519 | WP_030127443.1 | phage major tail protein, TP901-1 family | - |
| H7789_RS03415 (H7789_03415) | - | 659692..660060 (+) | 369 | WP_136084475.1 | tail assembly chaperone | - |
| H7789_RS03420 (H7789_03420) | - | 660081..660398 (+) | 318 | WP_030127445.1 | hypothetical protein | - |
| H7789_RS03425 (H7789_03425) | - | 660395..663145 (+) | 2751 | WP_228628310.1 | phage tail tape measure protein | - |
| H7789_RS03430 (H7789_03430) | - | 663145..663915 (+) | 771 | WP_030127447.1 | distal tail protein Dit | - |
| H7789_RS03435 (H7789_03435) | - | 663912..666020 (+) | 2109 | WP_136084473.1 | phage tail spike protein | - |
| H7789_RS03440 (H7789_03440) | - | 666017..667018 (+) | 1002 | WP_136084472.1 | hyaluronoglucosaminidase | - |
| H7789_RS03445 (H7789_03445) | - | 667034..668989 (+) | 1956 | WP_136084471.1 | gp58-like family protein | - |
| H7789_RS03450 (H7789_03450) | - | 668998..669159 (+) | 162 | WP_012560658.1 | hypothetical protein | - |
| H7789_RS03455 (H7789_03455) | - | 669162..669779 (+) | 618 | WP_111679844.1 | DUF1366 domain-containing protein | - |
| H7789_RS03460 (H7789_03460) | - | 669789..670064 (+) | 276 | WP_002987582.1 | hypothetical protein | - |
| H7789_RS03465 (H7789_03465) | - | 670061..670288 (+) | 228 | WP_000609113.1 | phage holin | - |
| H7789_RS03470 (H7789_03470) | - | 670404..671609 (+) | 1206 | WP_228628312.1 | glucosaminidase domain-containing protein | - |
| H7789_RS03475 (H7789_03475) | - | 671745..672869 (+) | 1125 | WP_023609814.1 | Fic family protein | - |
| H7789_RS03480 (H7789_03480) | entC3 | 673117..673899 (+) | 783 | WP_136084469.1 | enterotoxin type C3 EntC3 | - |
| H7789_RS03485 (H7789_03485) | - | 674012..674146 (+) | 135 | WP_136084468.1 | oxidoreductase | - |
| H7789_RS03490 (H7789_03490) | - | 674312..675037 (-) | 726 | WP_136084467.1 | hypothetical protein | - |
| H7789_RS03495 (H7789_03495) | - | 675034..675681 (-) | 648 | WP_136084466.1 | hypothetical protein | - |
| H7789_RS03500 (H7789_03500) | - | 675713..676099 (-) | 387 | WP_136084465.1 | hypothetical protein | - |
| H7789_RS03505 (H7789_03505) | - | 676111..676419 (-) | 309 | WP_136084464.1 | hypothetical protein | - |
| H7789_RS03510 (H7789_03510) | prx | 676599..676781 (+) | 183 | WP_136084463.1 | Paratox | Regulator |
Sequence
Protein
Download Length: 60 a.a. Molecular weight: 7055.00 Da Isoelectric Point: 4.0338
>NTDB_id=477364 H7789_RS03510 WP_136084463.1 676599..676781(+) (prx) [Streptococcus pyogenes strain TSPY1026]
MLTYDEFKQAIDDGYITADTVMIVRKSGQIFDYVLPNEKIRDWEVVTDEKVEEVLVELSR
MLTYDEFKQAIDDGYITADTVMIVRKSGQIFDYVLPNEKIRDWEVVTDEKVEEVLVELSR
Nucleotide
Download Length: 183 bp
>NTDB_id=477364 H7789_RS03510 WP_136084463.1 676599..676781(+) (prx) [Streptococcus pyogenes strain TSPY1026]
ATGCTAACATACGACGAATTTAAGCAAGCAATTGATGACGGCTATATCACAGCAGACACAGTTATGATCGTGCGCAAGAG
CGGACAGATTTTTGATTATGTGTTGCCGAATGAGAAGATAAGAGATTGGGAGGTTGTGACAGACGAAAAAGTGGAAGAGG
TGCTAGTGGAGCTTTCGAGATAA
ATGCTAACATACGACGAATTTAAGCAAGCAATTGATGACGGCTATATCACAGCAGACACAGTTATGATCGTGCGCAAGAG
CGGACAGATTTTTGATTATGTGTTGCCGAATGAGAAGATAAGAGATTGGGAGGTTGTGACAGACGAAAAAGTGGAAGAGG
TGCTAGTGGAGCTTTCGAGATAA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS315 |
90 |
100 |
0.9 |
| prx | Streptococcus pyogenes MGAS8232 |
81.667 |
100 |
0.817 |
| prx | Streptococcus pyogenes MGAS315 |
78.333 |
100 |
0.783 |
| prx | Streptococcus pyogenes MGAS315 |
71.667 |
100 |
0.717 |
| prx | Streptococcus pyogenes MGAS315 |
83.333 |
70 |
0.583 |
| prx | Streptococcus pyogenes MGAS315 |
82.927 |
68.333 |
0.567 |
| prx | Streptococcus pyogenes MGAS315 |
73.81 |
70 |
0.517 |