Detailed information
Overview
| Name | prx | Type | Regulator |
| Locus tag | H7790_RS05880 | Genome accession | NZ_CP060645 |
| Coordinates | 1190721..1190903 (-) | Length | 60 a.a. |
| NCBI ID | WP_011184726.1 | Uniprot ID | - |
| Organism | Streptococcus pyogenes strain TSPY1349 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1190721..1227050 | 1190721..1190903 | within | 0 |
Gene organization within MGE regions
Location: 1190721..1227050
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| H7790_RS05880 (H7790_05905) | prx | 1190721..1190903 (-) | 183 | WP_011184726.1 | hypothetical protein | Regulator |
| H7790_RS05885 (H7790_05910) | mf2 | 1191143..1191901 (+) | 759 | WP_011184727.1 | DNase Mf2 | - |
| H7790_RS05890 (H7790_05915) | speC | 1192012..1192719 (+) | 708 | WP_002985327.1 | streptococcal pyrogenic exotoxin SpeC | - |
| H7790_RS05895 (H7790_05920) | - | 1192788..1193540 (-) | 753 | WP_030126404.1 | CHAP domain-containing protein | - |
| H7790_RS05900 (H7790_05925) | - | 1193658..1194113 (-) | 456 | WP_011184730.1 | phage holin family protein | - |
| H7790_RS05905 (H7790_05930) | - | 1194123..1194734 (-) | 612 | WP_136073818.1 | DUF1366 domain-containing protein | - |
| H7790_RS05910 (H7790_05935) | - | 1194737..1195165 (-) | 429 | WP_011184732.1 | DUF1617 family protein | - |
| H7790_RS05915 (H7790_05940) | - | 1195174..1196955 (-) | 1782 | WP_011184733.1 | gp58-like family protein | - |
| H7790_RS05920 (H7790_05945) | - | 1196970..1198079 (-) | 1110 | WP_011054675.1 | hyaluronoglucosaminidase | - |
| H7790_RS05925 (H7790_05950) | - | 1198079..1200052 (-) | 1974 | WP_228631657.1 | phage tail spike protein | - |
| H7790_RS05930 (H7790_05955) | - | 1200034..1200729 (-) | 696 | WP_002992579.1 | hypothetical protein | - |
| H7790_RS05935 (H7790_05960) | - | 1200726..1203089 (-) | 2364 | WP_030126402.1 | hypothetical protein | - |
| H7790_RS05940 (H7790_05965) | - | 1203089..1203460 (-) | 372 | WP_011054678.1 | DUF5361 domain-containing protein | - |
| H7790_RS05945 (H7790_05970) | - | 1203475..1203738 (-) | 264 | WP_010922455.1 | hypothetical protein | - |
| H7790_RS05950 (H7790_05975) | - | 1203749..1204339 (-) | 591 | WP_011054679.1 | hypothetical protein | - |
| H7790_RS05955 (H7790_05980) | - | 1204355..1204690 (-) | 336 | WP_000573598.1 | hypothetical protein | - |
| H7790_RS05960 (H7790_05985) | - | 1204691..1204927 (-) | 237 | WP_000032787.1 | hypothetical protein | - |
| H7790_RS05965 (H7790_05990) | - | 1204920..1205258 (-) | 339 | WP_011054681.1 | hypothetical protein | - |
| H7790_RS05970 (H7790_05995) | - | 1205218..1205640 (-) | 423 | WP_011054682.1 | phage Gp19/Gp15/Gp42 family protein | - |
| H7790_RS05975 (H7790_06000) | - | 1205650..1205850 (-) | 201 | WP_010922460.1 | hypothetical protein | - |
| H7790_RS05980 (H7790_06005) | - | 1205850..1206761 (-) | 912 | WP_011054683.1 | phage major capsid protein | - |
| H7790_RS05985 (H7790_06010) | - | 1206786..1207247 (-) | 462 | WP_010922462.1 | DUF4355 domain-containing protein | - |
| H7790_RS05990 (H7790_06015) | - | 1207328..1208743 (-) | 1416 | WP_011054685.1 | terminase | - |
| H7790_RS05995 (H7790_06020) | - | 1208825..1209040 (-) | 216 | WP_011106704.1 | hypothetical protein | - |
| H7790_RS06000 (H7790_06025) | - | 1209042..1209308 (-) | 267 | WP_002986828.1 | hypothetical protein | - |
| H7790_RS06005 (H7790_06030) | - | 1209301..1209453 (-) | 153 | WP_011054687.1 | hypothetical protein | - |
| H7790_RS06010 (H7790_06035) | - | 1209530..1209754 (-) | 225 | WP_002994100.1 | hypothetical protein | - |
| H7790_RS06015 (H7790_06040) | - | 1209760..1211253 (-) | 1494 | WP_010922467.1 | hypothetical protein | - |
| H7790_RS06020 (H7790_06045) | - | 1211246..1212514 (-) | 1269 | WP_010922468.1 | phage portal protein | - |
| H7790_RS06025 (H7790_06050) | - | 1212511..1212868 (-) | 358 | Protein_1170 | hypothetical protein | - |
| H7790_RS06030 (H7790_06055) | - | 1213016..1213360 (-) | 345 | WP_011054690.1 | HNH endonuclease signature motif containing protein | - |
| H7790_RS06035 (H7790_06060) | - | 1213468..1213887 (-) | 420 | WP_011054691.1 | DUF1492 domain-containing protein | - |
| H7790_RS06040 (H7790_06065) | - | 1213963..1214214 (-) | 252 | WP_011054692.1 | hypothetical protein | - |
| H7790_RS06045 (H7790_06070) | - | 1214211..1214366 (-) | 156 | WP_011054693.1 | hypothetical protein | - |
| H7790_RS06050 (H7790_06075) | - | 1214363..1214680 (-) | 318 | WP_011054694.1 | DUF1372 family protein | - |
| H7790_RS06055 (H7790_06080) | - | 1214716..1215228 (-) | 513 | WP_011054695.1 | hypothetical protein | - |
| H7790_RS06060 (H7790_06085) | - | 1215225..1215557 (-) | 333 | WP_011184741.1 | hypothetical protein | - |
| H7790_RS06065 (H7790_06090) | - | 1215568..1216914 (-) | 1347 | WP_011054697.1 | PcfJ domain-containing protein | - |
| H7790_RS06070 (H7790_06095) | - | 1216911..1217306 (-) | 396 | WP_011054698.1 | Cas9 inhibitor AcrIIA9 family protein | - |
| H7790_RS06075 (H7790_06100) | - | 1217671..1218468 (-) | 798 | WP_011054699.1 | PD-(D/E)XK nuclease-like domain-containing protein | - |
| H7790_RS06080 (H7790_06105) | - | 1218461..1218661 (-) | 201 | WP_000594115.1 | hypothetical protein | - |
| H7790_RS06085 (H7790_06110) | - | 1218658..1219584 (-) | 927 | WP_011054700.1 | recombinase RecT | - |
| H7790_RS06090 (H7790_06115) | - | 1219587..1219917 (-) | 331 | Protein_1183 | hypothetical protein | - |
| H7790_RS06095 (H7790_06120) | - | 1219973..1220179 (-) | 207 | WP_002988357.1 | hypothetical protein | - |
| H7790_RS06100 (H7790_06125) | - | 1220188..1220328 (-) | 141 | WP_002988354.1 | hypothetical protein | - |
| H7790_RS06105 (H7790_06130) | - | 1220325..1220558 (-) | 234 | WP_010922205.1 | hypothetical protein | - |
| H7790_RS06110 (H7790_06135) | - | 1220539..1220925 (-) | 387 | WP_011017564.1 | DnaD domain-containing protein | - |
| H7790_RS06115 | - | 1221066..1221335 (-) | 270 | WP_011106700.1 | replication protein | - |
| H7790_RS06120 (H7790_06140) | - | 1221429..1221614 (-) | 186 | WP_010922477.1 | hypothetical protein | - |
| H7790_RS06125 (H7790_06145) | - | 1221616..1221927 (-) | 312 | WP_010922478.1 | excisionase | - |
| H7790_RS06130 (H7790_06150) | - | 1222197..1222409 (-) | 213 | WP_010922479.1 | helix-turn-helix domain-containing protein | - |
| H7790_RS06135 (H7790_06155) | - | 1222611..1223366 (+) | 756 | WP_010922480.1 | helix-turn-helix domain-containing protein | - |
| H7790_RS06140 (H7790_06160) | - | 1223378..1223896 (+) | 519 | WP_010922481.1 | HIRAN domain-containing protein | - |
| H7790_RS06145 (H7790_06165) | - | 1224020..1225162 (+) | 1143 | WP_003051793.1 | tyrosine-type recombinase/integrase | - |
| H7790_RS06150 (H7790_06170) | - | 1225251..1225526 (-) | 276 | WP_002983920.1 | HU family DNA-binding protein | - |
| H7790_RS06155 (H7790_06175) | - | 1225625..1226212 (-) | 588 | WP_002989129.1 | YpmS family protein | - |
| H7790_RS06160 (H7790_06180) | - | 1226190..1227032 (-) | 843 | WP_168391515.1 | SGNH/GDSL hydrolase family protein | - |
Sequence
Protein
Download Length: 60 a.a. Molecular weight: 6936.91 Da Isoelectric Point: 4.1954
>NTDB_id=477318 H7790_RS05880 WP_011184726.1 1190721..1190903(-) (prx) [Streptococcus pyogenes strain TSPY1349]
MLTYDEFKQAIDNGYITADTVMIVRKNGQIFDYVLPNEKIKNGEIVTDEKVEEVLVELSR
MLTYDEFKQAIDNGYITADTVMIVRKNGQIFDYVLPNEKIKNGEIVTDEKVEEVLVELSR
Nucleotide
Download Length: 183 bp
>NTDB_id=477318 H7790_RS05880 WP_011184726.1 1190721..1190903(-) (prx) [Streptococcus pyogenes strain TSPY1349]
ATGCTAACATACGACGAATTTAAACAAGCAATTGACAATGGATATATCACAGCAGACACAGTAATGATCGTGCGCAAGAA
CGGACAGATTTTTGATTATGTGTTGCCGAATGAGAAGATAAAGAATGGAGAAATTGTGACAGACGAAAAAGTGGAAGAGG
TGCTGGTGGAGCTTTCGAGATAA
ATGCTAACATACGACGAATTTAAACAAGCAATTGACAATGGATATATCACAGCAGACACAGTAATGATCGTGCGCAAGAA
CGGACAGATTTTTGATTATGTGTTGCCGAATGAGAAGATAAAGAATGGAGAAATTGTGACAGACGAAAAAGTGGAAGAGG
TGCTGGTGGAGCTTTCGAGATAA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS315 |
98.333 |
100 |
0.983 |
| prx | Streptococcus pyogenes MGAS8232 |
86.667 |
100 |
0.867 |
| prx | Streptococcus pyogenes MGAS315 |
78.333 |
100 |
0.783 |
| prx | Streptococcus pyogenes MGAS315 |
75 |
100 |
0.75 |
| prx | Streptococcus pyogenes MGAS315 |
83.721 |
71.667 |
0.6 |
| prx | Streptococcus pyogenes MGAS315 |
85.366 |
68.333 |
0.583 |
| prx | Streptococcus pyogenes MGAS315 |
71.429 |
70 |
0.5 |