Detailed information
Bioinformatically predicted
Overview
| Name | prx | Type | Regulator |
| Locus tag | H7790_RS00425 | Genome accession | NZ_CP060645 |
| Coordinates | 68628..68810 (+) | Length | 60 a.a. |
| NCBI ID | WP_011054856.1 | Uniprot ID | - |
| Organism | Streptococcus pyogenes strain TSPY1349 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 12574..81296 | 68628..68810 | within | 0 |
Gene organization within MGE regions
Location: 12574..81296
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| H7790_RS00060 (H7790_00060) | ftsH | 12574..14553 (+) | 1980 | WP_002981901.1 | ATP-dependent zinc metalloprotease FtsH | - |
| H7790_RS00065 (H7790_00065) | - | 14897..16288 (+) | 1392 | WP_002987685.1 | APC family permease | - |
| H7790_RS09445 (H7790_00175) | - | 23843..24124 (-) | 282 | WP_074375313.1 | transposase | - |
| H7790_RS00175 (H7790_00180) | pcsB | 24871..26067 (+) | 1197 | WP_115230328.1 | peptidoglycan hydrolase PcsB | - |
| H7790_RS00180 (H7790_00185) | - | 26320..27282 (+) | 963 | WP_115230329.1 | ribose-phosphate diphosphokinase | - |
| H7790_RS00185 (H7790_00190) | recO | 27468..28223 (+) | 756 | WP_002986719.1 | DNA repair protein RecO | - |
| H7790_RS00190 (H7790_00195) | - | 28355..29443 (-) | 1089 | WP_136022133.1 | site-specific integrase | - |
| H7790_RS00195 (H7790_00200) | - | 29693..30805 (-) | 1113 | WP_228631685.1 | ImmA/IrrE family metallo-endopeptidase | - |
| H7790_RS00200 (H7790_00205) | - | 30774..31133 (-) | 360 | WP_136022134.1 | helix-turn-helix domain-containing protein | - |
| H7790_RS00205 (H7790_00210) | - | 31300..31515 (+) | 216 | WP_023079578.1 | hypothetical protein | - |
| H7790_RS00210 (H7790_00215) | - | 31645..32418 (+) | 774 | WP_111706154.1 | phage antirepressor | - |
| H7790_RS00215 (H7790_00220) | - | 32498..32755 (+) | 258 | WP_011054895.1 | hypothetical protein | - |
| H7790_RS00220 (H7790_00225) | - | 32784..32954 (+) | 171 | WP_011054894.1 | hypothetical protein | - |
| H7790_RS00225 (H7790_00230) | - | 32947..33153 (+) | 207 | WP_021734004.1 | hypothetical protein | - |
| H7790_RS00230 (H7790_00235) | - | 33150..33533 (+) | 384 | WP_111706153.1 | hypothetical protein | - |
| H7790_RS00235 (H7790_00240) | - | 33678..33881 (+) | 204 | WP_011054890.1 | hypothetical protein | - |
| H7790_RS00240 (H7790_00245) | - | 33969..34268 (+) | 300 | WP_000573833.1 | hypothetical protein | - |
| H7790_RS00245 (H7790_00250) | - | 34268..35422 (+) | 1155 | WP_111706152.1 | DUF2800 domain-containing protein | - |
| H7790_RS00250 (H7790_00255) | - | 35434..35991 (+) | 558 | WP_111706151.1 | DUF2815 family protein | - |
| H7790_RS00255 (H7790_00260) | - | 36034..37956 (+) | 1923 | WP_111706150.1 | DNA polymerase | - |
| H7790_RS00260 (H7790_00265) | - | 37961..40345 (+) | 2385 | WP_111706149.1 | phage/plasmid primase, P4 family | - |
| H7790_RS00265 (H7790_00270) | - | 40732..41007 (+) | 276 | WP_136073826.1 | VRR-NUC domain-containing protein | - |
| H7790_RS00270 (H7790_00275) | - | 41004..42326 (+) | 1323 | WP_136022137.1 | SNF2-related protein | - |
| H7790_RS00275 (H7790_00280) | - | 42327..42497 (+) | 171 | WP_011054883.1 | hypothetical protein | - |
| H7790_RS00280 (H7790_00285) | - | 42490..42762 (+) | 273 | WP_011054882.1 | hypothetical protein | - |
| H7790_RS00285 (H7790_00290) | - | 42895..43311 (+) | 417 | WP_011054881.1 | transcriptional regulator | - |
| H7790_RS00290 (H7790_00295) | - | 43401..43853 (+) | 453 | WP_065358823.1 | terminase small subunit | - |
| H7790_RS00295 (H7790_00300) | - | 43843..45120 (+) | 1278 | WP_065358793.1 | PBSX family phage terminase large subunit | - |
| H7790_RS00300 (H7790_00305) | - | 45135..46667 (+) | 1533 | WP_065358792.1 | phage portal protein | - |
| H7790_RS00305 (H7790_00310) | - | 46633..48075 (+) | 1443 | WP_136022138.1 | minor capsid protein | - |
| H7790_RS00310 (H7790_00315) | - | 48103..48291 (+) | 189 | WP_065358790.1 | hypothetical protein | - |
| H7790_RS00315 (H7790_00320) | - | 48294..48563 (+) | 270 | WP_023611375.1 | hypothetical protein | - |
| H7790_RS00320 (H7790_00325) | - | 48810..49379 (+) | 570 | WP_023611382.1 | DUF4355 domain-containing protein | - |
| H7790_RS00325 (H7790_00330) | - | 49392..50279 (+) | 888 | WP_065358789.1 | phage capsid protein | - |
| H7790_RS00330 (H7790_00335) | - | 50291..50647 (+) | 357 | WP_023611376.1 | phage head-tail connector protein | - |
| H7790_RS00335 (H7790_00340) | - | 50658..50936 (+) | 279 | WP_000639437.1 | hypothetical protein | - |
| H7790_RS00340 (H7790_00345) | - | 50933..51277 (+) | 345 | WP_023611373.1 | HK97-gp10 family putative phage morphogenesis protein | - |
| H7790_RS00345 (H7790_00350) | - | 51281..51640 (+) | 360 | WP_065358788.1 | hypothetical protein | - |
| H7790_RS00350 (H7790_00355) | - | 51652..52251 (+) | 600 | WP_023611368.1 | phage major tail protein, TP901-1 family | - |
| H7790_RS00355 (H7790_00360) | - | 52305..52760 (+) | 456 | WP_023611380.1 | tail assembly chaperone | - |
| H7790_RS00360 (H7790_00365) | - | 52835..53068 (+) | 234 | WP_002983445.1 | hypothetical protein | - |
| H7790_RS00365 (H7790_00370) | - | 53083..57240 (+) | 4158 | WP_136022139.1 | tape measure protein | - |
| H7790_RS00370 (H7790_00375) | - | 57252..58094 (+) | 843 | WP_015986718.1 | phage tail family protein | - |
| H7790_RS00375 (H7790_00380) | - | 58104..60083 (+) | 1980 | WP_136022140.1 | phage tail protein | - |
| H7790_RS00380 (H7790_00385) | hylP | 60080..61093 (+) | 1014 | WP_111695808.1 | hyaluronidase HylP | - |
| H7790_RS00385 (H7790_00390) | - | 61108..62994 (+) | 1887 | WP_010922092.1 | gp58-like family protein | - |
| H7790_RS00390 (H7790_00395) | - | 63006..63437 (+) | 432 | WP_020837375.1 | DUF1617 family protein | - |
| H7790_RS00395 (H7790_00400) | - | 63440..64045 (+) | 606 | WP_094751271.1 | DUF1366 domain-containing protein | - |
| H7790_RS00400 (H7790_00405) | - | 64061..64516 (+) | 456 | WP_002988455.1 | phage holin family protein | - |
| H7790_RS09350 | - | 64518..64640 (+) | 123 | WP_027968869.1 | hypothetical protein | - |
| H7790_RS00405 (H7790_00410) | - | 64628..65824 (+) | 1197 | WP_094751270.1 | glucosaminidase domain-containing protein | - |
| H7790_RS00410 (H7790_00415) | - | 65961..66503 (+) | 543 | WP_048327805.1 | Panacea domain-containing protein | - |
| H7790_RS00415 (H7790_00420) | - | 66507..67343 (+) | 837 | WP_094751269.1 | hypothetical protein | - |
| H7790_RS00420 (H7790_00425) | - | 67406..68395 (-) | 990 | WP_050443212.1 | DNA/RNA non-specific endonuclease | - |
| H7790_RS00425 (H7790_00430) | prx | 68628..68810 (+) | 183 | WP_011054856.1 | hypothetical protein | Regulator |
| H7790_RS00430 (H7790_00435) | plsX | 69049..70056 (+) | 1008 | WP_002987696.1 | phosphate acyltransferase PlsX | - |
| H7790_RS00435 (H7790_00440) | - | 70049..70291 (+) | 243 | WP_014407187.1 | phosphopantetheine-binding protein | - |
| H7790_RS00440 (H7790_00445) | purC | 70442..71146 (+) | 705 | WP_017649245.1 | phosphoribosylaminoimidazolesuccinocarboxamide synthase | - |
| H7790_RS00445 (H7790_00450) | - | 71270..74995 (+) | 3726 | WP_136073825.1 | phosphoribosylformylglycinamidine synthase | - |
| H7790_RS00450 (H7790_00455) | purF | 75156..76610 (+) | 1455 | WP_032460537.1 | amidophosphoribosyltransferase | - |
| H7790_RS00455 (H7790_00460) | purM | 76638..77660 (+) | 1023 | WP_032460906.1 | phosphoribosylformylglycinamidine cyclo-ligase | - |
| H7790_RS00460 (H7790_00465) | purN | 77828..78382 (+) | 555 | WP_002986700.1 | phosphoribosylglycinamide formyltransferase | - |
| H7790_RS00465 (H7790_00470) | purH | 78566..80113 (+) | 1548 | WP_032460907.1 | bifunctional phosphoribosylaminoimidazolecarboxamide formyltransferase/IMP cyclohydrolase | - |
| H7790_RS00470 (H7790_00475) | - | 80172..81296 (-) | 1125 | WP_002987712.1 | CHAP domain-containing protein | - |
Sequence
Protein
Download Length: 60 a.a. Molecular weight: 6927.67 Da Isoelectric Point: 3.9286
>NTDB_id=477281 H7790_RS00425 WP_011054856.1 68628..68810(+) (prx) [Streptococcus pyogenes strain TSPY1349]
MLTYDEFKQAIDDGYITGDTVAIVRKNGQIFDYALPNEEVRNGEVVTYENVEEVLRELDK
MLTYDEFKQAIDDGYITGDTVAIVRKNGQIFDYALPNEEVRNGEVVTYENVEEVLRELDK
Nucleotide
Download Length: 183 bp
>NTDB_id=477281 H7790_RS00425 WP_011054856.1 68628..68810(+) (prx) [Streptococcus pyogenes strain TSPY1349]
ATGCTAACATACGATGAGTTTAAGCAAGCTATTGATGACGGATATATCACAGGCGACACAGTGGCGATCGTGCGCAAAAA
CGGACAGATTTTTGATTATGCGTTGCCGAATGAAGAGGTAAGAAATGGGGAGGTTGTAACATACGAAAATGTGGAAGAAG
TGCTGAGGGAATTAGACAAATAA
ATGCTAACATACGATGAGTTTAAGCAAGCTATTGATGACGGATATATCACAGGCGACACAGTGGCGATCGTGCGCAAAAA
CGGACAGATTTTTGATTATGCGTTGCCGAATGAAGAGGTAAGAAATGGGGAGGTTGTAACATACGAAAATGTGGAAGAAG
TGCTGAGGGAATTAGACAAATAA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS315 |
100 |
100 |
1 |
| prx | Streptococcus pyogenes MGAS8232 |
80 |
100 |
0.8 |
| prx | Streptococcus pyogenes MGAS315 |
78.333 |
100 |
0.783 |
| prx | Streptococcus pyogenes MGAS315 |
75 |
100 |
0.75 |
| prx | Streptococcus pyogenes MGAS315 |
88.372 |
71.667 |
0.633 |
| prx | Streptococcus pyogenes MGAS315 |
87.805 |
68.333 |
0.6 |
| prx | Streptococcus pyogenes MGAS315 |
76.19 |
70 |
0.533 |