Detailed information
Bioinformatically predicted
Overview
| Name | prx | Type | Regulator |
| Locus tag | H7791_RS05735 | Genome accession | NZ_CP060644 |
| Coordinates | 1173484..1173666 (-) | Length | 60 a.a. |
| NCBI ID | WP_011054726.1 | Uniprot ID | A0A5S4TS04 |
| Organism | Streptococcus pyogenes strain TSPY1309 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1173484..1213371 | 1173484..1173666 | within | 0 |
Gene organization within MGE regions
Location: 1173484..1213371
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| H7791_RS05735 (H7791_05730) | prx | 1173484..1173666 (-) | 183 | WP_011054726.1 | hypothetical protein | Regulator |
| H7791_RS05740 (H7791_05735) | mf2 | 1173906..1174664 (+) | 759 | WP_011184727.1 | DNase Mf2 | - |
| H7791_RS05745 (H7791_05740) | speC | 1174775..1175482 (+) | 708 | WP_002985327.1 | streptococcal pyrogenic exotoxin SpeC | - |
| H7791_RS05750 (H7791_05745) | - | 1175558..1176892 (-) | 1335 | WP_228634917.1 | GH25 family lysozyme | - |
| H7791_RS05755 (H7791_05750) | - | 1177004..1177189 (-) | 186 | WP_002990010.1 | holin | - |
| H7791_RS05760 (H7791_05755) | - | 1177186..1177485 (-) | 300 | WP_111713279.1 | hypothetical protein | - |
| H7791_RS05765 (H7791_05760) | - | 1177501..1178127 (-) | 627 | WP_115225213.1 | hypothetical protein | - |
| H7791_RS05770 (H7791_05765) | - | 1178130..1178558 (-) | 429 | WP_014411850.1 | DUF1617 family protein | - |
| H7791_RS05775 (H7791_05770) | - | 1178570..1180456 (-) | 1887 | WP_111702896.1 | gp58-like family protein | - |
| H7791_RS05780 (H7791_05775) | - | 1180469..1181476 (-) | 1008 | WP_115225215.1 | hyaluronoglucosaminidase | - |
| H7791_RS05785 (H7791_05780) | - | 1181473..1183452 (-) | 1980 | WP_228634918.1 | phage tail protein | - |
| H7791_RS05790 (H7791_05785) | - | 1183462..1184304 (-) | 843 | WP_015986718.1 | phage tail family protein | - |
| H7791_RS05795 (H7791_05790) | - | 1184316..1188473 (-) | 4158 | WP_228634919.1 | tape measure protein | - |
| H7791_RS05800 (H7791_05795) | - | 1188488..1188721 (-) | 234 | WP_002983445.1 | hypothetical protein | - |
| H7791_RS05805 (H7791_05800) | - | 1188796..1189251 (-) | 456 | WP_023611380.1 | tail assembly chaperone | - |
| H7791_RS05810 (H7791_05805) | - | 1189305..1189904 (-) | 600 | WP_023611368.1 | phage major tail protein, TP901-1 family | - |
| H7791_RS05815 (H7791_05810) | - | 1189916..1190275 (-) | 360 | WP_065358788.1 | hypothetical protein | - |
| H7791_RS05820 (H7791_05815) | - | 1190279..1190623 (-) | 345 | WP_023611373.1 | HK97-gp10 family putative phage morphogenesis protein | - |
| H7791_RS05825 (H7791_05820) | - | 1190620..1190898 (-) | 279 | WP_000639437.1 | hypothetical protein | - |
| H7791_RS05830 (H7791_05825) | - | 1190909..1191265 (-) | 357 | WP_023611376.1 | phage head-tail connector protein | - |
| H7791_RS05835 (H7791_05830) | - | 1191277..1192164 (-) | 888 | WP_065358789.1 | phage capsid protein | - |
| H7791_RS05840 (H7791_05835) | - | 1192177..1192746 (-) | 570 | WP_023611382.1 | DUF4355 domain-containing protein | - |
| H7791_RS05845 (H7791_05840) | - | 1192993..1193262 (-) | 270 | WP_023611375.1 | hypothetical protein | - |
| H7791_RS05850 (H7791_05845) | - | 1193265..1193453 (-) | 189 | WP_065358790.1 | hypothetical protein | - |
| H7791_RS05855 (H7791_05850) | - | 1193481..1194923 (-) | 1443 | WP_065358791.1 | minor capsid protein | - |
| H7791_RS05860 (H7791_05855) | - | 1194889..1196421 (-) | 1533 | WP_110407981.1 | phage portal protein | - |
| H7791_RS05865 (H7791_05860) | - | 1196437..1197714 (-) | 1278 | WP_228634920.1 | PBSX family phage terminase large subunit | - |
| H7791_RS05870 (H7791_05865) | - | 1197704..1198156 (-) | 453 | WP_228635035.1 | terminase small subunit | - |
| H7791_RS05875 (H7791_05870) | - | 1198246..1198662 (-) | 417 | WP_002988747.1 | DUF722 domain-containing protein | - |
| H7791_RS05880 (H7791_05875) | - | 1198796..1199065 (-) | 270 | WP_228634921.1 | hypothetical protein | - |
| H7791_RS05885 (H7791_05880) | - | 1199062..1199238 (-) | 177 | WP_228634922.1 | hypothetical protein | - |
| H7791_RS05890 (H7791_05885) | - | 1199235..1199402 (-) | 168 | WP_023079219.1 | hypothetical protein | - |
| H7791_RS05895 (H7791_05890) | - | 1199403..1200725 (-) | 1323 | WP_109981995.1 | SNF2-related protein | - |
| H7791_RS05900 (H7791_05895) | - | 1200722..1200997 (-) | 276 | WP_023613183.1 | VRR-NUC domain-containing protein | - |
| H7791_RS05905 (H7791_05900) | - | 1201386..1203770 (-) | 2385 | WP_228634923.1 | phage/plasmid primase, P4 family | - |
| H7791_RS05910 (H7791_05905) | - | 1203775..1205697 (-) | 1923 | WP_228634924.1 | DNA polymerase | - |
| H7791_RS05915 (H7791_05910) | - | 1205740..1206303 (-) | 564 | WP_086934854.1 | DUF2815 family protein | - |
| H7791_RS05920 (H7791_05915) | - | 1206312..1207469 (-) | 1158 | WP_011888943.1 | DUF2800 domain-containing protein | - |
| H7791_RS05925 (H7791_05920) | - | 1207469..1207768 (-) | 300 | WP_002988708.1 | hypothetical protein | - |
| H7791_RS05930 (H7791_05925) | - | 1207857..1208060 (-) | 204 | WP_023611025.1 | hypothetical protein | - |
| H7791_RS05935 (H7791_05930) | - | 1208057..1208407 (-) | 351 | WP_136097199.1 | hypothetical protein | - |
| H7791_RS05940 (H7791_05935) | - | 1208553..1208939 (-) | 387 | WP_228634925.1 | hypothetical protein | - |
| H7791_RS05945 (H7791_05940) | - | 1208936..1209139 (-) | 204 | WP_000049475.1 | hypothetical protein | - |
| H7791_RS05950 (H7791_05945) | - | 1209132..1209302 (-) | 171 | WP_023611037.1 | hypothetical protein | - |
| H7791_RS05955 (H7791_05950) | - | 1209331..1209588 (-) | 258 | WP_136019444.1 | hypothetical protein | - |
| H7791_RS05960 (H7791_05955) | - | 1209676..1209876 (-) | 201 | WP_227868729.1 | hypothetical protein | - |
| H7791_RS05965 (H7791_05960) | - | 1209927..1210118 (-) | 192 | WP_136019445.1 | hypothetical protein | - |
| H7791_RS05970 (H7791_05965) | - | 1210139..1210498 (-) | 360 | WP_136019446.1 | hypothetical protein | - |
| H7791_RS05975 (H7791_05970) | - | 1210792..1211142 (+) | 351 | WP_136019447.1 | helix-turn-helix domain-containing protein | - |
| H7791_RS05980 (H7791_05975) | - | 1211156..1211539 (+) | 384 | WP_002988673.1 | ImmA/IrrE family metallo-endopeptidase | - |
| H7791_RS05985 (H7791_05980) | - | 1211550..1212101 (+) | 552 | WP_047149516.1 | hypothetical protein | - |
| H7791_RS05990 (H7791_05985) | - | 1212274..1213371 (+) | 1098 | WP_063629417.1 | site-specific integrase | - |
Sequence
Protein
Download Length: 60 a.a. Molecular weight: 6771.70 Da Isoelectric Point: 3.9944
>NTDB_id=477265 H7791_RS05735 WP_011054726.1 1173484..1173666(-) (prx) [Streptococcus pyogenes strain TSPY1309]
MLTYDEFKQAIDNGYIVGDTVAIVRKNGQIFDYVLPGEKVRPSEVVAEEIVEEVVVELDK
MLTYDEFKQAIDNGYIVGDTVAIVRKNGQIFDYVLPGEKVRPSEVVAEEIVEEVVVELDK
Nucleotide
Download Length: 183 bp
>NTDB_id=477265 H7791_RS05735 WP_011054726.1 1173484..1173666(-) (prx) [Streptococcus pyogenes strain TSPY1309]
ATGCTAACATACGACGAATTTAAGCAAGCAATTGACAACGGATATATCGTAGGAGACACAGTAGCGATTGTGCGTAAAAA
CGGACAGATTTTTGATTATGTGTTGCCTGGCGAAAAAGTCAGACCGTCGGAGGTTGTGGCTGAGGAAATAGTGGAAGAGG
TGGTGGTGGAATTAGACAAATAA
ATGCTAACATACGACGAATTTAAGCAAGCAATTGACAACGGATATATCGTAGGAGACACAGTAGCGATTGTGCGTAAAAA
CGGACAGATTTTTGATTATGTGTTGCCTGGCGAAAAAGTCAGACCGTCGGAGGTTGTGGCTGAGGAAATAGTGGAAGAGG
TGGTGGTGGAATTAGACAAATAA
Domains
No domain identified.
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS315 |
100 |
100 |
1 |
| prx | Streptococcus pyogenes MGAS8232 |
80 |
100 |
0.8 |
| prx | Streptococcus pyogenes MGAS315 |
80 |
100 |
0.8 |
| prx | Streptococcus pyogenes MGAS315 |
80 |
100 |
0.8 |
| prx | Streptococcus pyogenes MGAS315 |
78.333 |
100 |
0.783 |
| prx | Streptococcus pyogenes MGAS315 |
73.333 |
100 |
0.733 |
| prx | Streptococcus pyogenes MGAS315 |
87.805 |
68.333 |
0.6 |