Detailed information    

insolico Bioinformatically predicted

Overview

Name   prx   Type   Regulator
Locus tag   H7792_RS04835 Genome accession   NZ_CP060643
Coordinates   990439..990627 (-) Length   62 a.a.
NCBI ID   WP_136022789.1    Uniprot ID   -
Organism   Streptococcus pyogenes strain TSPY416     
Function   Inhibit ComR activation (predicted from homology)   
Competence regulation

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 990439..1047046 990439..990627 within 0


Gene organization within MGE regions


Location: 990439..1047046
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  H7792_RS04835 (H7792_04835) prx 990439..990627 (-) 189 WP_136022789.1 Paratox Regulator
  H7792_RS04840 (H7792_04840) spel 990742..991530 (-) 789 WP_020833516.1 streptococcal pyrogenic exotoxin SpeL -
  H7792_RS04845 (H7792_04845) spem 991812..992525 (-) 714 WP_014635497.1 streptococcal pyrogenic exotoxin SpeM -
  H7792_RS04850 (H7792_04850) - 992881..994086 (-) 1206 WP_136115266.1 Fic family protein -
  H7792_RS04855 (H7792_04855) - 994271..995476 (-) 1206 WP_228650289.1 glucosaminidase domain-containing protein -
  H7792_RS04860 (H7792_04860) - 995587..995772 (-) 186 WP_111676573.1 holin -
  H7792_RS04865 (H7792_04865) - 995769..996068 (-) 300 WP_002993162.1 hypothetical protein -
  H7792_RS04870 (H7792_04870) - 996079..996690 (-) 612 WP_228650290.1 DUF1366 domain-containing protein -
  H7792_RS04875 (H7792_04875) - 996693..997121 (-) 429 WP_011018112.1 DUF1617 family protein -
  H7792_RS04880 (H7792_04880) - 997133..999016 (-) 1884 WP_136098460.1 gp58-like family protein -
  H7792_RS04885 (H7792_04885) - 999031..1000146 (-) 1116 WP_136098459.1 hyaluronoglucosaminidase -
  H7792_RS04890 (H7792_04890) - 1000143..1002287 (-) 2145 WP_228650291.1 phage tail spike protein -
  H7792_RS04895 (H7792_04895) - 1002284..1002991 (-) 708 WP_014411854.1 distal tail protein Dit -
  H7792_RS04900 (H7792_04900) - 1002991..1006914 (-) 3924 WP_029714351.1 phage tail tape measure protein -
  H7792_RS04905 (H7792_04905) - 1006927..1007094 (-) 168 WP_014411856.1 hypothetical protein -
  H7792_RS04910 (H7792_04910) gpG 1007124..1007450 (-) 327 WP_014411857.1 phage tail assembly chaperone G -
  H7792_RS04915 (H7792_04915) - 1007503..1008111 (-) 609 WP_011017585.1 major tail protein -
  H7792_RS04920 (H7792_04920) - 1008127..1008552 (-) 426 WP_011017584.1 hypothetical protein -
  H7792_RS04925 (H7792_04925) - 1008549..1008926 (-) 378 WP_003055321.1 HK97-gp10 family putative phage morphogenesis protein -
  H7792_RS04930 (H7792_04930) - 1008923..1009270 (-) 348 WP_003055344.1 phage head closure protein -
  H7792_RS04935 (H7792_04935) - 1009267..1009569 (-) 303 WP_021340811.1 head-tail connector protein -
  H7792_RS08750 - 1009572..1009700 (-) 129 WP_021340813.1 hypothetical protein -
  H7792_RS04940 (H7792_04940) - 1009714..1010898 (-) 1185 WP_021340812.1 phage major capsid protein -
  H7792_RS04945 (H7792_04945) - 1010923..1011588 (-) 666 WP_032465106.1 head maturation protease, ClpP-related -
  H7792_RS04950 (H7792_04950) - 1011566..1012786 (-) 1221 WP_032465107.1 phage portal protein -
  H7792_RS04955 (H7792_04955) - 1012820..1013044 (-) 225 WP_002985363.1 hypothetical protein -
  H7792_RS04960 (H7792_04960) - 1013037..1013207 (-) 171 WP_002985365.1 hypothetical protein -
  H7792_RS04965 (H7792_04965) - 1013204..1014958 (-) 1755 WP_136305188.1 terminase large subunit -
  H7792_RS04970 (H7792_04970) - 1014973..1015440 (-) 468 WP_002985371.1 phage terminase small subunit P27 family -
  H7792_RS04975 (H7792_04975) - 1015608..1015949 (-) 342 WP_029714359.1 HNH endonuclease -
  H7792_RS04980 (H7792_04980) - 1016185..1016370 (+) 186 WP_001132273.1 type II toxin-antitoxin system HicA family toxin -
  H7792_RS04985 (H7792_04985) - 1016422..1016799 (+) 378 WP_002987543.1 type II toxin-antitoxin system HicB family antitoxin -
  H7792_RS04990 (H7792_04990) - 1017094..1017327 (+) 234 WP_002995461.1 hypothetical protein -
  H7792_RS04995 (H7792_04995) - 1017417..1018331 (-) 915 WP_011284864.1 hypothetical protein -
  H7792_RS05000 (H7792_05000) - 1019102..1019539 (-) 438 WP_003052405.1 DUF1492 domain-containing protein -
  H7792_RS05005 (H7792_05005) - 1019808..1020443 (-) 636 WP_136305187.1 N-6 DNA methylase -
  H7792_RS05010 (H7792_05010) - 1020443..1020844 (-) 402 WP_002987468.1 hypothetical protein -
  H7792_RS05015 (H7792_05015) - 1021086..1021442 (-) 357 WP_023078113.1 hypothetical protein -
  H7792_RS05020 (H7792_05020) - 1021426..1021710 (-) 285 WP_227874671.1 VRR-NUC domain-containing protein -
  H7792_RS05025 (H7792_05025) - 1021730..1022599 (-) 870 WP_014635521.1 bifunctional DNA primase/polymerase -
  H7792_RS05030 (H7792_05030) - 1022866..1024419 (-) 1554 WP_011017876.1 hypothetical protein -
  H7792_RS05035 (H7792_05035) - 1024437..1024919 (-) 483 WP_085577342.1 DUF669 domain-containing protein -
  H7792_RS05040 (H7792_05040) - 1024924..1026357 (-) 1434 Protein_944 DEAD/DEAH box helicase -
  H7792_RS05045 (H7792_05045) - 1026363..1027046 (-) 684 WP_014635524.1 AAA family ATPase -
  H7792_RS05050 (H7792_05050) - 1027043..1027327 (-) 285 WP_011284877.1 hypothetical protein -
  H7792_RS05055 (H7792_05055) - 1027324..1027518 (-) 195 WP_002984315.1 hypothetical protein -
  H7792_RS05060 (H7792_05060) - 1027518..1027847 (-) 330 WP_011284878.1 hypothetical protein -
  H7792_RS05065 (H7792_05065) - 1027928..1028065 (-) 138 WP_002984309.1 hypothetical protein -
  H7792_RS05070 (H7792_05070) - 1028062..1028379 (-) 318 WP_063631315.1 hypothetical protein -
  H7792_RS05075 (H7792_05075) - 1028458..1028643 (-) 186 WP_011054585.1 helix-turn-helix domain-containing protein -
  H7792_RS05080 (H7792_05080) - 1028810..1029049 (+) 240 WP_011284879.1 hypothetical protein -
  H7792_RS05085 (H7792_05085) - 1029147..1029869 (-) 723 WP_032460391.1 phage antirepressor KilAC domain-containing protein -
  H7792_RS05090 (H7792_05090) - 1029920..1030147 (-) 228 WP_002990088.1 hypothetical protein -
  H7792_RS05095 (H7792_05095) - 1030244..1031023 (+) 780 WP_136022810.1 hypothetical protein -
  H7792_RS05100 (H7792_05100) - 1031157..1031315 (-) 159 WP_111711563.1 hypothetical protein -
  H7792_RS05105 (H7792_05105) - 1031374..1031586 (+) 213 WP_136022811.1 hypothetical protein -
  H7792_RS05110 (H7792_05110) - 1031575..1031724 (-) 150 WP_168389386.1 hypothetical protein -
  H7792_RS05115 (H7792_05115) - 1032081..1032836 (+) 756 WP_002990090.1 XRE family transcriptional regulator -
  H7792_RS05120 (H7792_05120) - 1032874..1033554 (+) 681 WP_002990092.1 hypothetical protein -
  H7792_RS05125 (H7792_05125) - 1033691..1034830 (+) 1140 WP_002990094.1 tyrosine-type recombinase/integrase -
  H7792_RS05130 (H7792_05130) rfbB 1034924..1035964 (-) 1041 WP_111676461.1 dTDP-glucose 4,6-dehydratase -
  H7792_RS05135 (H7792_05135) - 1036208..1036801 (-) 594 WP_002984882.1 dTDP-4-dehydrorhamnose 3,5-epimerase family protein -
  H7792_RS05140 (H7792_05140) rfbA 1036801..1037670 (-) 870 WP_111713817.1 glucose-1-phosphate thymidylyltransferase RfbA -
  H7792_RS05145 (H7792_05145) - 1037728..1038834 (-) 1107 WP_111713818.1 NAD(P)/FAD-dependent oxidoreductase -
  H7792_RS05150 (H7792_05150) - 1038874..1039662 (-) 789 WP_136284791.1 Nif3-like dinuclear metal center hexameric protein -
  H7792_RS05155 (H7792_05155) - 1039652..1040338 (-) 687 WP_002990104.1 tRNA (adenine(22)-N(1))-methyltransferase -
  H7792_RS05160 (H7792_05160) nth 1040410..1041066 (-) 657 WP_002990106.1 endonuclease III -
  H7792_RS05165 (H7792_05165) - 1041063..1041746 (-) 684 WP_002984890.1 DnaD domain-containing protein -
  H7792_RS05170 (H7792_05170) - 1041827..1042345 (-) 519 WP_002990109.1 adenine phosphoribosyltransferase -
  H7792_RS05175 (H7792_05175) recJ 1042496..1044706 (-) 2211 WP_111713819.1 single-stranded-DNA-specific exonuclease RecJ -
  H7792_RS05180 (H7792_05180) - 1044703..1045467 (-) 765 WP_014407517.1 SDR family NAD(P)-dependent oxidoreductase -
  H7792_RS05185 (H7792_05185) rnz 1045467..1046396 (-) 930 WP_009881223.1 ribonuclease Z -
  H7792_RS05190 (H7792_05190) - 1046411..1047046 (-) 636 WP_002990114.1 cystathionine beta-lyase -

Sequence

Protein


Download         Length: 62 a.a.        Molecular weight: 7268.17 Da        Isoelectric Point: 3.9282

>NTDB_id=477206 H7792_RS04835 WP_136022789.1 990439..990627(-) (prx) [Streptococcus pyogenes strain TSPY416]
MLTYDEFKQAIDNGYITADTVMIVRKNGQIFDYVLPHEEIRDWEVVTIERISDVMAELSESE

Nucleotide


Download         Length: 189 bp        

>NTDB_id=477206 H7792_RS04835 WP_136022789.1 990439..990627(-) (prx) [Streptococcus pyogenes strain TSPY416]
ATGCTAACATACGACGAATTTAAGCAAGCGATTGACAATGGATATATCACAGCAGACACAGTTATGATCGTGCGCAAGAA
CGGACAGATTTTTGATTATGTGTTGCCGCATGAGGAGATAAGAGATTGGGAGGTTGTGACAATCGAGCGGATATCAGATG
TTATGGCAGAACTTTCTGAGTCTGAATAA

Domains


No domain identified.



Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  prx Streptococcus pyogenes MGAS315

76.271

95.161

0.726
  prx Streptococcus pyogenes MGAS315

77.586

93.548

0.726
  prx Streptococcus pyogenes MGAS315

71.667

96.774

0.694
  prx Streptococcus pyogenes MGAS8232

72.881

95.161

0.694
  prx Streptococcus pyogenes MGAS315

88.095

67.742

0.597
  prx Streptococcus pyogenes MGAS315

85.366

66.129

0.565
  prx Streptococcus pyogenes MGAS315

76.19

67.742

0.516